08qSi<  qSi*>t tqSi@@<@T 08qSi<  qSi*>t tqSi@@<@TU qSit`AqSiqSiqSi$h qSiqSiqSiAqSiqSiqSiA.qSiqSiqSixAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSimD6qSiqSiqSi (08@HPX`hpx($wqSiqSiqSiHPX`hpxN$0qSiqSiqSiK$/qSiqSiqSi (M$JqSiqSiqSi08@HPX`hpFAqSiqSiqSiCqSiqSiqSiAqSiqSiqSiAqSiqSiqSi!qSiqSiqSi aqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSiaqSiqSiqSi aqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSi!qSiqSiqSi4!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi B!qSiqSiqSi B!qSiqSiqSi!qSiqSiqSi"!qSiqSiqSi"!qSiqSiqSi"aqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSiaqSiqSiqSi aqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi!qSiqSiqSi !qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi!qSiqSiqSi !qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi !qSiqSiqSi!qSiqSiqSi !qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi?\!qSiqSiqSi>\!qSiqSiqSi=\!qSiqSiqSi<\!qSiqSiqSi;\!qSiqSiqSi:\!qSiqSiqSi9\!qSiqSiqSi8\!qSiqSiqSi?\!qSiqSiqSi>\!qSiqSiqSi=\!qSiqSiqSi<\!qSiqSiqSi;\!qSiqSiqSi:\!qSiqSiqSi9\!qSiqSiqSi8\!qSiqSiqSi:\!qSiqSiqSi7\!qSiqSiqSi6\!qSiqSiqSi5\!qSiqSiqSi4\!qSiqSiqSi3\!qSiqSiqSi2\!qSiqSiqSi1\!qSiqSiqSi0\!qSiqSiqSi7\!qSiqSiqSi6\!qSiqSiqSi5\!qSiqSiqSi4\!qSiqSiqSi3\!qSiqSiqSi2\!qSiqSiqSi1\!qSiqSiqSi0\!qSiqSiqSi2\!qSiqSiqSi/\!qSiqSiqSi.\!qSiqSiqSi-\!qSiqSiqSi,\!qSiqSiqSi+\!qSiqSiqSi*\!qSiqSiqSi)\!qSiqSiqSi(\!qSiqSiqSi/\!qSiqSiqSi.\!qSiqSiqSi-\!qSiqSiqSi,\!qSiqSiqSi+\!qSiqSiqSi*\!qSiqSiqSi)\!qSiqSiqSi(\!qSiqSiqSi*\!qSiqSiqSi'\!qSiqSiqSi&\!qSiqSiqSi%\!qSiqSiqSi$\!qSiqSiqSi#\!qSiqSiqSi"\!qSiqSiqSi!\!qSiqSiqSi \!qSiqSiqSi'\!qSiqSiqSi&\!qSiqSiqSi%\!qSiqSiqSi$\!qSiqSiqSi#\!qSiqSiqSi"\!qSiqSiqSi!\!qSiqSiqSi \!qSiqSiqSi"\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi \!qSiqSiqSi \!qSiqSiqSi \!qSiqSiqSi \!qSiqSiqSi \!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi \!qSiqSiqSi \!qSiqSiqSi \!qSiqSiqSi \!qSiqSiqSi \!qSiqSiqSi\!qSiqSiqSi \!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi\!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi!qSiqSiqSi !qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi !qSiqSiqSi!qSiqSiqSi !qSiqSiqSi!qSiqSiqSi!qSiqSiqSi$!qSiqSiqSi4!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi !qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSiaqSiqSiqSiaqSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSiaqSiqSiqSi aqSiqSiqSiaqSiqSiqSi aqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSi?\aqSiqSiqSi>\aqSiqSiqSi=\aqSiqSiqSi<\aqSiqSiqSi;\aqSiqSiqSi:\aqSiqSiqSi9\aqSiqSiqSi8\aqSiqSiqSi?\aqSiqSiqSi>\aqSiqSiqSi=\aqSiqSiqSi<\aqSiqSiqSi;\aqSiqSiqSi:\aqSiqSiqSi9\aqSiqSiqSi8\aqSiqSiqSi:\aqSiqSiqSi7\aqSiqSiqSi6\aqSiqSiqSi5\aqSiqSiqSi4\aqSiqSiqSi3\aqSiqSiqSi2\aqSiqSiqSi1\aqSiqSiqSi0\aqSiqSiqSi7\aqSiqSiqSi6\aqSiqSiqSi5\aqSiqSiqSi4\aqSiqSiqSi3\aqSiqSiqSi2\aqSiqSiqSi1\aqSiqSiqSi0\aqSiqSiqSi2\aqSiqSiqSi/\aqSiqSiqSi.\aqSiqSiqSi-\aqSiqSiqSi,\aqSiqSiqSi+\aqSiqSiqSi*\aqSiqSiqSi)\aqSiqSiqSi(\aqSiqSiqSi/\aqSiqSiqSi.\aqSiqSiqSi-\aqSiqSiqSi,\aqSiqSiqSi+\aqSiqSiqSi*\aqSiqSiqSi)\aqSiqSiqSi(\aqSiqSiqSi*\aqSiqSiqSi'\aqSiqSiqSi&\aqSiqSiqSi%\aqSiqSiqSi$\aqSiqSiqSi#\aqSiqSiqSi"\aqSiqSiqSi!\aqSiqSiqSi \aqSiqSiqSi'\aqSiqSiqSi&\aqSiqSiqSi%\aqSiqSiqSi$\aqSiqSiqSi#\aqSiqSiqSi"\aqSiqSiqSi!\aqSiqSiqSi \aqSiqSiqSi"\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi \aqSiqSiqSi \aqSiqSiqSi \aqSiqSiqSi \aqSiqSiqSi \aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi \aqSiqSiqSi \aqSiqSiqSi \aqSiqSiqSi \aqSiqSiqSi \aqSiqSiqSi\aqSiqSiqSi \aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\aqSiqSiqSi\ !qSiqSiqSii!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi aqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSi aqSiqSiqSiaqSiqSiqSi aqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSi!qSiqSiqSi!qSiqSiqSiaqSiqSiqSiaqSiqSiqSi!qSiqSiqSi!qSiqSiqSi!qSiqSiqSi B!qSiqSiqSi B!qSiqSiqSi!qSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSiaqSiqSiqSi!qSiqSiqSi!qSiqSiqSiaqSiqSiqSi aqSiqSiqSiaqSiqSiqSi aqSiqSiqSiaqSiqSiqSiaqSiqSiqSiqSiqSiqSibpf!qSiqSiqSi $qSiqSiqSi$qSiqSiqSiv$>qSiqSiqSi$qSiqSiqSi$sqSiqSiqSi$qSiqSiqSiAqSiqSiqSim qSiqSiqSi$qSiqSiqSi $qSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSi!rpo7*R"DXO,/\ہfNb2!r6C HO\G+]u&`|'6d*lSTj<yH B4׸LwF7:9.S.Pmx TuEQ D"=GCPrjƪ8W AV &VUZzL#cAF ?w(){ZXTOA&4.2fE=m\6*mxc\h>Y1b-_-a0oF06Yfh ek=3jHhBii;J'wVzwUe(QeGF4NT)Y= sHX/ӊ<}1Um{DBEs]L>|H{G 7/) 9jlG=G!5+=Mk\Yw5?'Q֜+Y 'E $Kt . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(434 (^^d_dd\' LLd_ddNetBSDPKwGPaX NetBSDearmv7hf3D0D 0p@-h6!F(F;hFh@oKihB F^I&H F^ I&H;h+?U H)FCN*jB K Fhh! ^(e tXt \t (t 0MF Fj@2iF^C!jH M0# 05 H^J I H IhF^FHiFKh(Рmdt@t FIH^$( I H hH^FIHKh( F@9t%@t FIH^( I Hp h #H^FIHKh( F@t0@t C4IFFH% $:g KXbpG(!KXbpGx!I I  ֐I I  hh^oCFO2H#"#K] !oCFO2H#"#K ](x!oCFO2H#"#K ]4(!?#F "HlK]@h!?#F "HVKK]Xx!(! KFh[ ?#H" 8K]!dx! KFh[ ?#H" K]!v(!oCFO2 H##"KC2 $]p!?#"F HKF`  F$xBIOr-A#@L#F?I?O#V#hY;JBD#CS#`#h7J@*J)=4I @F,hF 1IBF =!?*F-IF#;Cx*I*F)I#"$"hhB"IhC#`Ch@FG_HJKFJ`! KC#C#`#`LKKIKx!!(! #=Bˑޑx(x!`E8KLhMchk`#B#A khc`##81bh;a??xE][|!(!x!KQKpG(!x!J IJ IkF[ijG bj IkpCj_ iIG#j( ""C#b6##j"G??Ch+#jCm8@FУhHch$h#H####$\oH## #$Po"hH$J#H##$> Ma@ B=\h O +`V+iNkaAܳгokj+;{Ka#a#3`OwK,wKa #a *juKuH*Fa@aji3hO;;3`i1hB3`+j+@вoвfI beKa #dIaiaH$6 g !#f C +j+$'PK@C!OJPHA j+3hAFMJMH2MJ2i2BFJK$j;IKIJJH #F$HHhDKOq9JOsE{|AFHFA/[F9FFPF@F FAFHFA##F @FFHFAFA#1FF@FF 2Cv# @! #4ZF+FH$2怅!R6֕̕•!Z@`5|flIF@F@ UOsEOA|  wFGFH+k+?j+#H$ $h" kk+"}H$ohiBx 9F@fCF1FF@8F FF8F@Y#3 $ NȱBFAFiH$0$h NЧF h 2h 2 2C# @! #FLH$HKKj+ xcQrVzDH !2F+FxAH$,vmiBz09F(F@SFIFF@F@FF9F(F@#F @FF9F(F@#1FF@F1ZF SF&H$)F8F@ /BOA)F8F@  /BOA)F8F@1I{"+F2F@!Hؖܖ!F!2F I *&`9F@6DB pF Mk i#U>`4!؇!g H!Ї!!-OFFFF(H%#&DB { x405BI%H x ^+\(\  HYF<( 5O500 x00 x00 g 8I"@ h#jF ` I\( ۽0+;J`0+;JS`]H!ht@ KZh B)iBHo H!D-GFMFliO !+iB$4 F4FFi+ #"#9FF0F7P F,̿4,i$kiBHIoH!&-CFF0H:oL0B̿H F FFB (F2()i;F"F@ (-hLFDH!KJh30 Hoa9 Ki" 2 #Da o 0H!B Kh30a8Ki@Hoo H!0-CtMuOli:h`3xY2I +"*6` )ŀ.Èé..ooooooooooôÓ^0-и^ LD"0?ظظ @:h30 A2@ (I@#HI "`CF;3@h"+@HWo F20ZԸ-и^ O3#DO3 3H@z#.I "`CF;3@jh"+*и.0/li*/YBYA0xBEz30u*К Xxjj;0jikh`3k`,i[B,+iBڤO4H!o Ї!GD#Lc`ci3chh( 320`x,* ;* bh*F#*c`h ѣ` Z x;+`aBу H!! L FF  +U{3B:!ElH!8F Fp@hIFH"RHp F8##+iag B <\+9 N0 3h8"#3`3iSIH($H.F>(F 0F9Fc I F,/*/"bU"ZpH3iI" F H![bJ1h8#@ C`H!F H  S;"@hO1#@;H!'8Mha1da, *1I @B"``3x 3F30, *ћ+2x.*rx *0300FF0;0S+h F" jiFQ`B#10;0++hԛ8FFF(oH!@g -GFILSBhn8&E+(EBEA030%0FF@FhF1ea0hIFN#10;0+_ hKMѽ%2FAF H0;0+4o#i9F B̿z*F(0FhBF*@FF8FF03`^`00hB¿h5=D#h  8FF@FF H!-GF2Lh2gaBF ܺB ]OO -4 '00F30%F0;0#h J* 0;0##hԛ6h=`i=F'0=Fbi@FFF(oH!-C F*LF FF 0300;0+:#h 2 L#i9B̿h FHF1Fh9F?#i5p[9#10;0S hѽo H!-OF`LF'#iB̿H F0FFUEW!{B ۷=F0Ou5D30)FM(\0hP;0##hgԚjEJAF10FScF(y0>3fa0 (Cbi(FFR(<0"!;0+%h9;(F(FF(M*i1:DB< y1IF@hIFH"XHw0;0#h  l0h;0##hԘYF*i8D?+i-hDQoH!ȓg F,La.3v01F30F@jh~!IF!H"!H0;0#h  0j`;0sQqjB .D#<(F#hԛ;x\+{x7?+7H!g -C#Ll2CЯH!sF o!B=@B0 F5D30)F@hIFH"H0;0+#h @ 0nP;0##hԙ1%@!"p x +8"B!@B0.F6D301F(0b;0##hԚ*Fo?1Q"ZU8x!XBXAt!+B%+!nB$۵F0Oy  D30IF(?o0n;03#h?z?|0!xSU0Yx\)љ[xU5F|B0!B!EE.F0FF6D301FI(?10n`;03#h?<?>0nZ x1ZU1 [x (H1a+DB!ݳv 1F2 (?0n`;03#h??13Np DBvp{0++1{HH!gg H%F>aCB!ݳv 1F2 (?0n`;03#h??1>F+D++Q*>D!J1h8#@ C`H! KF1x!+ I> /! F; H  H!fg7KL0x *7IJh+P1E *DH 0 *! 0x!+0(00HR-8u0)F30?h%IF%H"z$H0;0+#h ; 0P;0##hԛ# x )"TV(QYxTH!o g K-AhL F E1P0m (x /!ŲY-Y(Zf?gJp>U;V%EF Fn)p)l) x + JHEE1 ho(FaiFF( F+n*p*l*0 x +1 (`iE0EEaiFF( F+n*#p*l*0 x +1 (#B3caE0EE1#2+Dch+HwSx310Z Hoo H!қ,F(?r% F+n*=p*3l*60 x +M!i (Ye/(R(3x 1KN!0F(@LJ#1O3`J`5E0EE!+ОH"1F:n3x+H ch+Sx310[F(? x!+ѓH%E0F+n*p*l*0x +ޮ xH":8HTEE1 }H!i F(ҮG @ (ŮG/V/(F1)F31(E0 F+n*p*l*0 x + EEbh*?%Fn)p)l) x +pRJx+?PIQH!zEF EEbh*?ݮ%Fn)p)l) x +F22+?REF EEh 4H,%EF Fn)p)l) x +1 2h8EE`iA#F( F+n*p*l*0 x +1  B?E0EE!L!g Dh`Wx(%3F+n*p* l*03x +-9FZEF0EEaiF( F+n*p*l*0 x +@(%@0@@aiF(xLF(pch HYh.'#iB?#FE۾BڠHIE0 F+n*p*l*0 x +41 P0F?h"+9Hb/D~'!Ї!Gp*r*-[x +)џHE0x *"HE30EE2E#2x *0b30 iRF0;0+ƫ#h "" hB (#b20;0##hԞ=!2R# gIX(C2Ճ# 2 xn+7p+&l+.aiFyF(i F+n*1p*'l**0 x +E1 a!2C22 2C2CE0EEaiF5(&F(ch+?h.լ#iB?Ѭ F+n*p*l*0 x +1 0FE0EEbh*?Z%Fn)p) l) x +êEF EEX(!Q(0O5%x310Y)aF(?!ich C73 F+n*=p*3l*60 x +}1;3x!+ АH"1F93x+1+?`NHI#W/F0F(p#iB# t(dE0EE1+?V2+QqMoIbh*? F+l:Ҳ* x +gH Fai `D2F("0x1;+?\I "\N`&0`@80>h"+ UH5`E0 F+n*p*l*0 x +٩FK*Fhh#iDBFPEE%EF Fn)p)l) x +ch[h4H!EE!ich+?&(% F+n*$p*l*0 x + 00V2+HE0EEai `DF(shF޻ HZoj!qЇ!G@'HS+ ]pGL!0Ix^+0x]+0x]+ +[+Dx.۲+ % F/F])ѢB0 ) F 0 F-GFP,F#xB +0e(!BU@B4O.F6D,;h1F3;`(7>h+IF+H!n+H;h;;`(Kh 0[+\+ 4F(Hq&0Fcx +HF g;hJ`;;`+Khԛ,a*F0F>K"rU@h+)F0F #GԿ؇!g H! `!Ї!L!,Jphx (*H! ( (L01'H0FpY`[x +ЃBKF!L0Kh۹LK&)F0`Kh0(J@'0p0a Z0(>h/ IF H!HЇ!L!4!8!g -OaNbL3hZ2`Zx%*@𱀚xJE@"h33`ZH h  ;h;;`30񇀙3hZ2`x#h *ZU3h*x*@;3`bhB@BCO.F6D h;h1F3;`(I;h;;`+:KhWԛ#h"`ZU\*]Z2`x5"h + 00Kh{̰̀)(=П0D< +53hbhxKE E۵F;hOxD h3;`AF(>`huIFH H;h;;`+kKhi 0#` 0O%]FЇ!!X؇!H!܈!g !@g #MF `F`*hx /J`##`  +hx *кB3+`x1)>$I "`(h 0`@80>h"+H4`og*3+`#Ї!!G-OMFNF/h*hh0B"ۜB@BO&F6D:h1F2:`(;h`;;`+yKhKԛN+i"U=:x&*^  Bܤ KFSE*iH۪ Eȿ#FD  {2hYF22`>zh]IF]H ]H.3h;3`+o FSKh  3h;3`+JKhԙD\3PT\*Yzx 1)S0:BOX E ܤ KF[E*i5۫ Eȿ#D/O q:h2:`9> h &IF&H &H;h;;`;h;;`+KhԟՒD\3PTFB@B2h'F7D22`9F(?Z3hp;3`; Kh?j?l +iU44!؇!H!g -O} FF#{(Kh#!i #"#i"# /F0O@F }FM` h7Bg E?XADq(i 030 >^hsIFH H0;0Kh + 0;0+vKhԙ0 ( 3# " F}(iZF!F0D>*BFQF F[h@Lo E3ADq(i 030( >hRIFRH QH0;00;0+JKhԛ0+# "QF F((iRF!F0DFF> !D x(BذD?  E'ܠIFOq10D30(?>0;0;$Kh?H?J/ 2CHBh  C"!F"(?쮪 Kh+# "9F F(i:F!F0D>h J+i# +?Ʈ`!!g H!ȓ؇!-OO$BLFBMF0&h;#`>K hKE &`S`9Ho h0 `:FF^ >!hFb(+Ji +hO 3+`0FF+h;+`+"Kh \ "hFeB+h;+`+Khԛ&h  XFF$F(:F1F0F:( \!؇!T!&!H!P!-O[O[N;h3h3sh3VHVoSL#hRK"`T 030S $(F(<+F # C |Ol E ^AKh v3h0sh;`s`0;0+a7KhV  S2 ܾ' `FZXZP :Dhh  JhPhhh`P`JhhPh`P` hQ` ; =?a [X!6!!܈!H!\!؇!-A &M2; Y J#+`Kh`JhZ`\ Y/ D+`hThhB F FDF#F!\!X!-CF LFFh"hB#hO bh8F P#50F h`0Z"`d1  "`'B(М IF H H*`h !g >IFFH  Fg -O]NF FF3h˹IrhK* FG()FH ipCO>&#`o Ob)F8|o@>?# FY(pCOгhS FYh(pCO3hkh[+x/+0(FYVH)F FYd3hCF@!F(F<(8~H"F)Fz (#FxJvOa >ovOb!F 8 :F(OajJ ` " `Y(eH)F/!(F(W/! F(QG9F@F.#0*@FYF๼B<.#0P@FYꐹ PBBTBB?~3i;$si F+dpCO^Yh(w!FF'F)F@F=FRF!F@F=< i+]йZ(OX8F:$&IX"F 0;0+@F,(F8F (0' Y/IHWX`O ## 0#cf%E#c#cE &ȋ!ht@` !Qdxv#"cdff#cdf###`##`#Oa' 1#'cbb#cb#b#a##d##b##g#cg#cd#f#g#g##a#0##0#cdE@=IFH K#n Km KK+++KK#n Km KKKKKI 橞g feedIded[e_dswt8FKh<jFHD\ D88!8FKh<jFHD\ D88!l\ $J@A, AObXZC=hIFHB  ]Bh@AiJ B#THKJhhC @Kh# @ AHg  0!4! !K\hjHXHFX8!hplKJhhCKAh˱K "!!JCS!b 0I H`pKNhK*FKhU(OsAq6F F0Fp@XOԋ!؋!!&>N!2%! Kn:f*oB (КmQeppGIXo@g g pC O س_гO I * @O г`O% /  | @ = 9K-AFhmF,#4HF3Kh۱3Kh+5 #"2/K!#r0,I \+H9FD)K)JhhC40F&KDhC%KhKhpCOѨhD FKJhK) FFKh<OsAq;,F F@F9FK0FhpЋ!`؋!!&>h0!4!,!h !!(!0!4!,!h+a+F$2C@ƀ.8.$#.IO#@HKOsBF:C@5O#"#h96??;h+###.@o;`.O`*K)Jh`)J`+%JOC`OH$Kw. IGQ0B )OX.+OX!P!8"!b &Atm8@0!,!#OEF=`UO S;`z*FC9:6CѸ=`.UFKFO.?~9 KMi+ Lch+ݠhOBiFV(`` M!#LcbKi #"#h9j F ;Jh mO0h)V(! Ki* I O0h(K JIhh瀌!ơ9"0!F FF&"F)F8FV($D,D.0FF FF&"F)F8FV>($D,D.0FpFM Flh,Nh1i)FV`J#s`hB`3` FpVN#s`l`D;jJh j FIm!0!6WsFKMlh, FFhBFGN#kbs` Fpsk`3i;+7(7;^h +=+.u_3I O0O3c`.qP#'"h8$ ;'Jh8F)c+ڣj+!I"F!h8 ),;Jh /K.`u0F)F9~CII#h0VJ(; Jh # c`!%T0!mǤ-O]{O{K F:hX x*FRtHV20[bS#"F20+:;h+ʀ!0F##eJV|dK:FV<9 `J;FOq@F]J3FOQ,@XJXI(Fh ]t0ӱQK!0F##GJ|MJOQ r댨9,F Vj;h+DK!VhBKJF8FV<97JKFOq@FR;J;F6K 6Oh)J0 yh1Kj!0F:0J!@F(I  1  L9x FJOqHFJOQf猨9팩F Vg,kg !9"\!6P!wL8!^9"H!X!-CXMYNYLh+#3`30 C#i+NKOOh8hGMKMI8hh8h7*hIIhVFhjpCO$2C`iVv`@Kh+?Kh+(h(!VhV(h("0 C #i+ ,O2H9h)K8h"`7O3`2C#3`)O#3;hj3b0 CML+h# h#+`;h۱KHh9塀KOR%hPOI9F F(FIJ , h7P!!h9"t9"9"!9"9"ȥH!8!ͥl9"9"-AMI V(;tJh " V(;dyJh wNxLsjp+^0CZL0#qKrHheipI(F9z(nI(F9t(#i3+j)F?gHfHfKh;+9dHpaHaH`H`H@A(F(\I(F9>ع#YH0O3s`VK"`O78F MRHQHQH+x jxOH)F s+ S+ Y+`i(aiHHy+FHĀCHwCHt@A(F(4I(F9(+x;Hb0#8I j6HU5I(F94H(F9@CB0H(F(F$8#(I0O3s``a%H)F'|9"ڥ!9"Bhئ#KsHh9"ȓç@gw"fԨ4:"KFhC F0O0 -OL =OOu-Kh+,I <,()I"FH4n$Kq"hBFB8 I O0((>0+I HOq$&H!FiGL#(  W) !FH J`W P!5Q! 9"-GO $7H0Fh95F)FB#кXO5(F +I H(L'Kh+&I&I 85FO $"0I!H[jG0iF RIJF$H%F4 kH!FG(5F H Kh+II "k HG(232P!ZX!Q!ɩ9"/!MFH4F'p1FH船h/##p-K)FJ 3O0 MK0Fu")F9/#X;9FK JE#p \!P!1hF;`+ V9hZ` "ppG-OMO3F+hm( (+hjG(+h kpKhFF+7рL4 F FeF( F((O3uKh F# F(.@΀nI" UkKh  (ڨ FT(оbK4+`O"FU(:(8ZJh uP ;+! FKKHIH#y/+ 8KH92JIFH4/ F FEKh+ F(0K@J+hZFKF F(O +;hIB FlG(UC F(2? F(: F('! F(!#y/+ `8H8IFH4KBFHKFVKd0[:zJh ;hjGI" U aU#AW(9"X!\!]!g @g |9"-O/0 /[M+hlG(+hjG(( SKhF[QKhU:"OJh pMKhùMNT+hjGII" Ug z(ڷ ++hIB FlG(8KSA F(0KS# F(+Kh+*HUD((O;h C#HU6ﰹ:h0B`CXRhBAKBA F(! F(+Hc+KB9"8" 9"X!|9"!9"\!9"ȷ!X!!9"#y/+ 58tH8tIFH3qO0:hClHU0+g;hKB`CXRhBAeKBA[aO;hKaJ+hTZF_H43h [Kh ZKh+ (;4+B +@;+9OHF+5<1YAکP;h+?ٮCO;h+?Ԯ +<;+ P( HP9"z9"X!9"|9"\!!ȷ!9"t9"h9"P!9"X!l9"9"9"|"FU( 98Jh EP=P!ګPAFPF(PHAFH疪X!X!8LKbh#`KhZhb`O IOC O5(F8IOsK``Kh( #D 2((!`!9"5!KL#`Kh+bhOIOC QO0IOsKh( #hh D 3(`!(!f!KJI`OB ``pG(!`!CK-OFF?I  >L#0c` (O9HF2PGwO{*F0F[F9F8g BzڭK *FFQF(? h0j -z / iB!#h(&"h0DaDa`2 b2( K"`hiDa I 9"¬(!p&N-sh;$Kh+#I rO0p((K L%1h h( #haDa2Br 2rh*5B I ?(ۄ%(%(!Z FIiaFFU5(!S-OFٰ%FSBC XmQEU 120"& 9aKh+2O 8F1FU(=Oz&,VKhUKhTjRKh0Bu)8F  B,Cs2U~(9SCJO98h0F9>JCFh  8F  (+9S3J8h O92BA BCX0)sAF8F3(O9HFYBCX0BB RICF( Z 1FU( 9lSJ8h BBBR ICF(9"(!bͭpL-jMN)h ht( #haDa2Br2p 3h#b (ۄK"O0`(!9"9"P-A  2N2BOtqF FDaaPеh*F#F7DCFDjFPFD!F(Ft(O00mdD[B2-t2+OqqnBOqFЈB*Fq FFiFDdaFF (!-CFP FF.(F #( @(ܭ-ȿ(FB0FFFIF8F9v6 'D(!-OBCFX OVhF88FTPOz # ,v#*/5,v(2C$O0'9 3J[Fh m@JBv8F"F(/F$Kh &C4 /*BCX)[hsYF8FJ0hFO E ѼD0$fvbDO U4BIZF 瀭9"-(!-AFDL- #*s'%' h0BA!DAq-#h!4Fi*F9F+Da0B BA*I W (%K"O7`#Kh#hB+Da'8Fua(26DBr2#h2FF9JF3DaKhYi)0F#)(0"hBDa܇(!W9"9"8 Li#hB ٥i!*9Kah8@X8(!-AFO FL- C,=iB1F,F&DF"F9-F#DaO0(!-CFdFO-v C,8hOyBv 0O,FF"FF9F#D,0f %FO0(!-OBCͰFFQXVh 1F"hFF9=KhiF8FT&( 9~S7J8h -v U)T.I( FK#*1Bv8F*FT('0-fvD0&8FT(T96J86BBTI(O0 T9 J8h i VM9"b(!F8*TTT(9J+Fh >TD(94Jh . J#4`8 `8"0F(FiFT>(!Kh '0B CXRhBBB0CXRhBBI*F  9"0 FFiFT( '0Kh۹pCOI F7 FT(-9t J#Fh O0 FT(Kh5`9`J#F9"HKt9" 𵯰FF6F4#g##9'N3h&Kh  FT쀻3h[## J!Kh[##J!iF FTL`9hN+9J#Fh [/9 J#Fh Q-iF FT0 MbfpF FFT p2F)F FT (Kh59J#Fh  O0t9" FT hKh59#FJ@h t9"˯-GFxFF/+O80O/ (FO /!5,F(EЀiF(FT`@(Fn0/##piF(FT됻p@@O0&Kh#:F1F(F!(FT(iF(FT`(FAqa#jF(F`O&O09"-CFh#x/+ 1Mhh(0I"#k`O09 "C@AT0UVH9#h"J3h dN3h E\'0`!h;FJ1r,4(80C@$8F<@0 K$h54 JAF 04`!D`8">Ut9"_9"-AF FFFFT8(@.Kh (BBBB#I2F O0pCOI F7h FT(8J#Fh  FT(/ !F0FT(8p F(/J3FAF 9"pHS0F(4pCO)BCXSh(s RRBA## E `iF(FT0pCO  I*FO0'0#"#iF(FNSF( P Q# 18pG-AF]VD,S(89J#Fh ;7Kh;@$ F<F2Jh(?+=( F .K.JhhC""RS 3 F#h4۱5 F)FS( 8J#Fh  FTJ#4`(t'`g(t(@0CTZ TV#0 '9"9" `8"-OV @@2(tO )FM@FLFF4;+KHh7v숹Khs  YF FT00pC O9F F,X8"𼀺"шKh+𾀅J#FQF b,@2 FSCu8}J#FhOyKh0@$ F< *(@(HF4́+*dKjHh7 ! FTZ(  FYFTB(8`JKFh Gq F#R)h 2 F0#VKh+$SU 3QJBJA"HF#>z,FTPGWS9F3 FS#SXGG9F FSP(qh#"2###jj [IjYJij aAj VJ[jUJZO "  m@F7(4(jpCO`&س_XгO4г_rsh @Bj2:sh@B `PT0j2,9K9Hh6(X w O7г@OLгO#4S3###4$Kh+RS 3RR #H#4## AO@b4S((8zshJjhd#  ##si"Z`t8"p9"Բ*9"ȥ>pFhF#N J A,B FvO@JJ^ ppXb?K-Ah FS;IBF F FASýV(:S 3 #!<!F@&*K*I/F(F F#s#844;+c#ؚj FKѲ3 C "Ir CFI Fl4 (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@*I B F` F4# FIT+ I B!F l9"&neS 3#F9S(H#07F FC5.p!x 0?"hF)FhF)F F0@S{DFB*OЙB+0,08FK ,F+0 ,08BA,78a,W80%)O4BB7;$)'ѕB CO0 0= )@pO F03W3kpP0!@DpP0ЕBB F FpDBҐ0x+FB)F; +-*OF8ЬB;0;ڲ*APqAq@ECO2?oEBpBu7k AaF F;0ֲ . AqAqBAֲ. Aq 3Aa;ڲ* Aq 2AAqO0F0;D,&ѓBCO0 0; -@pO,F404W4\pP0!@Ap04IPГBB FKh(  IO2` 9"-A F-O!-LF9`!hy.Mih!` x-) !yO &I1 !q!ya!h  !`!!q)F0FASAFFDF3zh*hCFIH?$z)F0FASʻ:,Cx:+ KhBU"2`9` F*hCFIO4~'8"` g  pG hhSxs"F5C FA2oBoCAF$%F F)FpBxm*% b*k*x**"x* *w*ѪBrjaBRBr0 FFBR*!B20aCDBqF F-Ax3$I ,O0!F I vFI,!`u4 :00  `HF;x+,!8F3F#p=!8F3F(I0FP'F,U8"sFF@J`%(Fp< +4 FFK"`<1F"F7#+U8"IH g lKhQЂB` I HhIHdIH`IH\ g wq-GFFOIHFI  F@ F8FfCF 7v J;Fh 0F/#cUVF8-OF/!h(?0M)FF(J#OpP%,F.FF`;`KO JXFCKhKh_SJ)+@K`0C@Chhz(<S i'equyAGMSY_'''+;u '`3K(` 1I 0@` 7,K+Khx-**JYx#``#&K"%K&J`%K%K%KKh+#H0@΀ K"`"K` 0K"`J#`J`J`Kx9"4:"` t9"g ,!U~'!9"!k9"9" q9"8"9"9"9" Kh(> vKK KKJ030Kh0$Ku E 4(F{F I0 7JhE6 NF Z`KJ[KKRKPwKh(?^wK~JI~KJF}K~JC{K~J@zK}J=xK}J:wK|J7|K1gKhjK1zK+zKbKh[vK#0OsI`*୸+S߀ohFPIPF6(ЀNIPFf(@ʀRFJIJI6(@ƀp4+#OFO }F(ѻ'8F2IPF6%0+?qRF/IV8F-I6(X0HFO 30~'l9"9" !9",9"9"9"!ND:0&9"9"g 9"8">C9"$' I"HF6踹030'8F1 O &FHF'#_"9FHF(#TqK#FNF'hnI8F5`ch+?׮04030"8F4(ݭ#F>X{_EF'h[I8F5(h`h(?ޮ4!(ЮSI5(gh/?ͮ4OI8F5(FMI8FFF:FhhEF!(ڞ !{(O @FeF(ѹ8I8F5@F%0+?:F/I5|x+I"XF5^ !IFXFO 4!8F%KF0$Kgz;#J%XF KAFK3I@J `K`K#@C IHM,@I0;0+򐂰1 #@g $$g t9"nWg $z*̀5309<{TZpv%+~#&QS%D"MD(hK(`?*hI 7K"D` K"D`KDhK`K"D `KJ`K"D@`K"D`K"Dt`}KDth0ڮIxK"HMhK>ϼDdaЬe_ ؾ  !`sI`` `rI*` `!)``mInIbFDdZKh?(DTgK"DT`eK"DD`cK"DD`D4}KM"+h]KL#[K`D4l*h XIqXIXHB#WITH"L#TIQHPIRH2xK#=I@=H\$_0Z "p[ h+4K5J`5L;++?y1L#hEt"FP#m(=#h3#`+c&KhE%I  ;S+"K`0պ!R#/(#h3#`#h[EK"`;~'9"9"9"9"9"!4:" G 0.g 9"0` |9"Khh`pG8"KhбK Ihh8 K Hh5@#I HZ8"9"9"xҺg 1F"2`F[?-'O*-+,B$[-+̼ Ex!-ф"DFe(F4(Fkx "x0;0=U F5`48 ([ P E :  #^0`v.+O0- FF"x !cx0:0;3D+Q4sa"x cx40:0;3d"SClssa,090:"Dsa"Fcx 09F31;3a"Fcx 0;09F3`"Fcx 0;09F3`"x !cx0F0:0;3s`$?? O0 d3o FEM/hS@=I:F y=I# +x##a v;x{!F8F0%2I:F \=/&a*c* C*M* &iFm*&iF$I;F ? F#iC#a#И0@F0IBF#iC"aBA I;FBF  Fwg#ca Kh` ``hTatU2:"-CFK FFh@=4FW! Fѹ 0I  h(BBѽ@F#eG$:" Lch !@``( IO0:"CK-OF_h/ZX4+K84+FB0CP@ShPF4W!F\F LF#BEBB) i, F( `U##ca9G&@ ) FI >O0!h @@B0 4+ ##4i;a+i h0 F :""K-AF\hS8$*-4+);+&B0CX@0F4V T!@U 5#EBiBB F+ѽ h09 FA4:"K-A\h&T4OV_]/Fi8h8F-ѦBѽ:"Lhs!LGPy`0I O0JKh S BB L h)K`05#h Jh  hP :"9"9"- Lh !@ 3`( IVO0:"Q L#h !@= `( I(fh(F1F36(0FE(F<``( I O0LF0F3 F0I:"iF KFFh h@"T @T!h(F30ah:F(F/$0`h:"p%)O4BB/.3O.O TliTB CO0 piT@Dp039P0#B9 FFF0OpB DB0[(DDK-A]\F@. * F7JO.#BD#<x/+20JkF@   (AO0 ]^*) .'D|3F^D?)D3FO<p\'JkF@   (JkF@  v (ڽ JkF@  h qo pFh FF*F3e-p@(e"PEF/0F h#(F#`3`pF F IO`!KhOp!pGO`0:"0# L#`\3  hX`ah!`!`(̿  0O00:"8FxO08I"3Kȹh2"` IU"FOqF(F O0"`v.pNrFȱ%hI(F3dh I F3|pI#F*F " K J I O0p3h;+ I#F*FK"`e{o0:"-AFFOq0F0O0BB! FU4tS #840K;+cK@A @A ` @\K "dFBH"F (ls"F<tk" !@|??Dy`" !TB`BPBPBK`PBpBK`PK`S hC 8 &2)-1):Ж($/5)<#BB4#($84K*K) " "$T }hQBC]`!C#4(4C C(43y/+"#3q `#4#84(4CCBB($BBxhX!QBX`C!C !<:"D:"-CWŰF4;+: 9("((Kh;&0FETI( TI(T}I(T{I(  BAr 0 R "O0 ɶECT>I(g[B@<#@<9K! COS#(F(<#F( @#(#%@F #IF|F(z@(F#1F(#lF(j@(F(O6 !B(4 +?&0:"?^{8" pG pGpF.xcI"0F3FI0F3JShi CCI F#a"FsOqF(FFBFI2F O4 Fpv0:"Q-CFFOq0F0O0BB! FU4 S#84Yq_@FY@B//#DG;0K;+ٝK@a1@F@A8D ` @K "dF" ! (|wBC ??P" !B`BPBPBK`PBpB0P)K`#QH1("tF@Q#<1 (1Z("lF<WG H 06+ 0+٣3*rEE.$g+أK*}#4BCXZBy`G,"G#(4CC x+IJ#4(4CS(4#4(4CC(4#84#h;y/)#`#q ($4+I BBBR($O ##F4="FFQ6*K#oCCH<#H<2+($B B#($4#BB4#($84JRhK+ # #4BCXy`ZBG,"G# I JK+ F I, J I &Y<:"D:"{0:"v-OW}F4+++СFY;c+<ݷJRh+ d;KDxF32/*ѥ +[IJF;++ Kkxl<+=+/ Ckxl|+#F Lkxl&+#F Ekxl=+!#F > jx+*k' 6jx-*k( 0) .% ,# *$ (#F %#F ",FF  o L;"ғ@;"H;"4;"=FKHh0;"nKs[hM.h+` XK.`0FH"xK*F3z"` F0^F F3phx3jh3IxJ\ HL3(F!Fp0;"\G"ғpFFF#- _iXfm {6E'.2~ t=HR;HO(ѳ??6H ,1FFp1CC3DAa?  @ !CC@?   XA@XCABq BA !BABqBB  BB @@P@Y@CC-OFF t0%+F F,U G9Fv0&+FFH##FU1FG;FFPF,CMFDFF F(F!F0;""K𵍰#FF#u,F F;F2FF F(F!F (Р +^9FF F/. TF F F FJ!T" ~0;"8 FMh)+8+!F0;"-OFFFFO O ,p,x,7,:ZH,##LFF$,v",1FHF0#+F F MH:'+عnIH  QD EE'+#.ѹ'8JOO3#FE68h" 8hF F## kK #%#3F9FFHFhC $$##3F9FFHFWCCv.', JO4$&F$F!E"' 0;"-OFFFF@##F9+FF F@+ FF1  <E$"F@F FECF:F0FF F+ _-G FdM*hS#S4FZ{_I8F1F(\I8F1F(&FFO E\,@.Yx0)_С\ز(|+zyyyy{kymoyyyyyyyqyyysyuyw F(hCh;C`+g *hhY`p;FFK,0k(hCh;C`+U *hhY` "pZ;+Ѹ (hCh;C`+K *hhY` "p(h *h0?##I S39F$ xF10(B0F$$ $ $ $ $ $F$hZ`hZ`O_&]hZ` BjnF)HF FhBhB< + C#O;h+@"Kh"I"H {h#zhIH H2F)F ,IH FIFH 2,F,L hCh;C`+ &"hhY` " Hp@ hZ`\;";"BzJFh>!`\;"FK aXi0XaO0 F\;"K\i"a"FiF aDDM Kh3 K60 F! 2( 2\;"DB"Kh "` ;"RK` ;"FS[2)Fh FF FF22F)Fh FFO0R FFO0 FSK2!Fh@pG8 FF2*F!F8@hO0R]pG FFO0 JF0 H ! J HBѲBPh2dt;"}KhpG;"pFMF h( ")FMBF hM&``h( "!MCF`hMf`(FpO57MHf+hhK"6 N K\h\-h Kh#F2F(F8`hBB $h F0dD"&;"H"F$O Fh5' *<#`0F)F0 JF! FgZag ++8#x6+ cx0+I" F,p F0"D=0+<.+0F"pN@;"K"`"apG;"7FmF 0#h;+h ")F[h#a iH ")Fw" FYhsdhhhh a0M,jH"F!D00(bB H!D0 K,jhy"`#q F0L(j{,b;"\Fh+уhch@Kh"hh3H"h-GF!:O0FO5F;h3;`FhFsh@F+^F0K\b;h;;`#.Kh h1`h#hhF0 -(FL1hFHrh@Fah:"k;h;;`#0 -!(F +L! w`h!-(FLPL|$hp;";"l;"-G F(F^`p! @  |O_!h)4euoEU~jK^b&jKh v0+dKXj(. u`hQF^0[KhhC, `h!^0#SJSjhC]`h!^0+JKh*[j+;h &)F F8$)F FlNF;h )F Fb;h `h!]^0+4Kh*Zj*h,\b;h QF F;h QF FH;h QF F;h "iOK"Zb`h!!JSj[ Sb`h!KZj*";h F")F F H H / <D";"F"-OF! FjK! Ftt&h` @EF K^bױ ^0kjhE F& 0+HIF\G";"(-GH(Mh7%L $K & hh0*x  0;Jp0+k +0+xF;F=F+{#hF K(FjlKXjK"Zb;"HB"-AF!LF&i3ahh!/^0h+#i;#a+ #`+ #i;#a+#`ifb;a;+fj*hcj * +Ѩhhfj++;"-GF4GLF^`fj  soh/[ `i3a/h)i0+/7K7Nh0 }5H zh w0hCh;C`+= 2hhY`="pxh 0hCh;C`+0 2hhY` "p0h "yhh thAF^ fj"h;+#i;#a+`?h"QF8FhhhZ`hZ`+#i;#a+`ifb;a0;"H"$\G"-CFF Nh`h"3`Oh,/h #"h dh+i(F3`Yh L# #hAFh +#ieh3`{j5,Fh^P-{b mh#F\G";"-GFhF|*h J 0chSMKNNhNK0h KH 3HH -GH 0hCh;C`+- 2hhY` "p0h >N-3h3`! FRF!FF(R-5OHFSW#{b'IF0h " 5hZ` t(,(3h;3`#%Kh h! `hG3h;3`#Kh -И0㱣hӱKhK0hG #H KGh -'wxbH"\G"*>Mp;";"l;"QPK0ɰhh##*JK0ӱhHKHMhHK0h EH hCH ?Kh D!F` 6K`hFF;VF˼-ѐ- рx8 Kp(%F (  0 +QD"x0+?;+ JB?JB? TIGU'x03+ (x)9) KB@3hF3Qx-(Hx(-(ъx*Fh# C + }K"Z`h`@"` C O3wKk MvK!h+ (@jpK+`oKh3B@L h +Y\#x0xbL9!`` `I h"c2 `^J!`"]I `]I ` b[JhJ"JG`b PK` TKUJ`UKUJ` # RK`FK"Z`* c2@ ;KB@6+ 8KhQ`hR`"`*@Z!+ٸ#!J F-hS`I*FF n;"\ -AF F*sL$>Kh3"1FhFF%ah5H 8F T A2H O2H L)0H1F rz.Lk hCh;C`+B "hhY`*"p hCh;C`+8 "hhY` "p4H H1F H-M`h+h3+` FhF"+h;+`#Kh H  HH1FhZ`hZ`H"&>GPp;"l;"Z`d8FL h0*xxB%+`h8)F.(4\8FL h@x+xB)F.`h84ܘ K "0%h I:0Q;+г(,۝rh;"-CFL%dd#h3#`|-#h;#`Kh˱C+0[ChB h;`8h(5+0Fp;"l;";""K-AFhO6Bt%3xF+B:*,F:)*lM+h+"..` F.`l<:+5F*%*. H9F&(.F,F.$H"-A&MX+h3+`|.+h;+`˹KhA0+ #h`h;` F00 (F#h;#`;Kh#0@0p;"l;"!@0+@h  -O&FF5F4FHeP9h xc+,CTЂHp(v(V(DO%zH0 h*@uHvJc+FuH F rOW (9! FqF(K-ClH h !+j(7iH$ hgH "0hsdL hCh;C`+( "hhY` "p0 h,PFx#xB!F.( !FXRH QH $hZ`AF FFر`.dVZ^C" F `'L `;Kh3/! F+[F0"!F$C;=-I!K-H/F #H&Kh! FJ(-$H /2hFF H s-H-H-HH DO _O~ \O Y&9cqNH"XdD"-OaLFaMF#hF(h#h` .>Њ.؀.:.2 .'/.3SI h: `*`kF *Q"eJeJJeJeJeJeJeJJ)JF@F=J z9N0b3h33` hxK3H CF(J*$,"O /*ј0/+ 5F"pj/K :* Ҳ * 2h:2`**hQ)`2h:2`* *hQ)`ZFB*`B*`<<"HB"b֕-AF)LcikhB 'N'O`h@hBϿ`a`$Kca3h33`;3h;3`+;h+"#caFh[aaNOcihHhBȿ`XhB"3h33`ci3h;3`+;h+<<"p;"l;"@<"7Fx F!+$Kh0 0@+*+ Khh"E;S/ x* 0; +/# "` F F/h+x =+T Kh-+x+KhBۛhD: *G;.0+F0rByF I"FO  h(3"&sD;+K 0 ;+ ۲ +0;0#;0;0R `0 #F<<"p;"l;";"HB"֕FK-OF[iFS {h`x`>KFOZhVh:K3  IDEѸ#x+ D`UF xɲ)Hف(UF k+O.F#5BЕ  85qE8*\*F5F*x-*&jx]*#Ё*\*5k#1 ( #6 (ؿO 5BO 5F *?OFDF*"ғ-OFF F #x*+N?+L[+@cx!+^+'ѣxx.2]*<[*&Zx:*&Zx^r]*/*Ё*њx*/*/*@#x/+(Dg4c:*њx]*À3F*3x/**3SxҲ*ف+4 UL+FfjxxҲ*ف(1 x+ 1B`j)`jJ(BL$BICBx/+E#<F($0B/#<#x+5&k;FF xɲ)ف(F0@F./#<x F1xҲ*ف( F+F+BӯHH& 3(F/+*/#!F<@F F(Z{.*Ѻ. "8F(.(F$;3 <<"Hl;"FpFx3ɲ )F &x<p,XpxQ-ً,p+F F,F+pFF$M$NbhF;C+j`h`#F$h+b*+?+[+hj3h/j33`PF-oO`hbahhj#kb3h;3`# Kh -+jB"`8h8`Fh(<<"p;"l;"8FM8+j`h`x,b$h<<"-CFxF0۲ +رB'O1 FO  F xZYF B<"ZU*ѽ:L *++*- F"xB   =* ЊB MHE*FF !.PF+D%+HF+5!F ғ-Gvxv F FO#00F !. #F0и/ N F-#<=O3h;3`+KlHB"gfff *-OF#xF-+F +@򉀣! *|L[?+v@+0; +m.Z# "` FzF.Ph+^x =+Y,@KhF/CNMLx+E\ ;+ +h;+`+#hZ"`"p+h;+`+S#hY!`xpqK&qMԡhBK yc0fO;0+;hZ:`"yp6bK_Lh!h$ `^K^K^KC;`#yp@/VKhOJ!bh,KLW;+x+1#hGN;#`+3hZ2`"p#h;#`+3hZ2`"p;h+#h;N;#`+d3hZ2`"pC3`#pxC3`#p.N=x+0 ;+ #h;#`+3hZ2`"p#h;#`+S3hY1`xpLC3`#pEZB2`xp#h;#`+ S3hY1`xpx+ћ*ZB2`xp C3`#pmlD"֕HB"<<"@B";"LD"KNLZhVhK3KY;+?# /@x;0+?𒀗ЇK0 ;+ 3h;3`+t#hZ"`"p3h;3`+q#hZ"`0 ;+ 3h;3`+#hZ"`"p3h;3`+S#hY!`xpC#`#pZB"`xp 3۲ + 3h;3`+#hZ"`3h;3`+S#hY!`xpx+цiC#`#pbZB"`xpO UC#`#pNC#`RA*N/Kx+?G6Jؠh;`+0Z p7,C0p0X-KhBShDOKSJA`pRF0F ,@DSBJO,W )ALF ( uC_/0+  F) њ)ښ@)њ =*O(`hI h: `B Q!p'B "p \I h: `* Q!pTI h2 `B "pOI h: `* Q !pB "p( QB): &/8I h: `* Q!puB "p,L+1ɲ ) !h9!`)H p h8 `(D@ )p *FA!p=D@Hh1`f  F)@gF *F@h  h FH"\G"HB"(<<"Kh8`(C0kpச ~*ۮ=)+?ծ#)F F,C0B pTFHB"-CF:KFf0 "7L)Fh'a0ih#`1Kbg`hga0/K`30vS030 `p#hp;0+*#hZ"`p h0c F"AFj#j"`+i )F#j"`i*qh `s`oC#`pQ 6#jG`` b<<"\G"HB"X<""FuKh@0-OOq4Lܰ&h01O;h;;`+FO#hZ"`"pP0F15D(F@0 h!K(FhF Fn#h:h0D `D;`+ `!J~!h F+F+*ѹ"3D0FY#h@F=+D#`;h[;` C#`#p<<"HB"\G"-O*(NF(O!!FiFF9;h3;`0`KahUDи*HF")F3h 5`;h;`3h"p#x+H*FI  Ja H KFJF9<<"HB" nd-OFrO+,FFi9 9! D0308``K,ah5DVDM ,|,!,FO B ;h"pJF)F0F(fфл44tO BӔJF)F0F(K#FНB ,* *Fx)22B8FtBJF!F0F(AbЕB <+ +Fx)33B8FJF!F0F(#x+44BӉ,Fuc:h=C3D;`>00B t;?;h<`0;0+ c;`##p;h;;`030C;`#p<<"HB"-CFLFxh!p'ha0ga#`Kh00;0B#hZ"`p0 h"1F0F F;C#`p<<"HB"-AF-LFA,H hCh;C`+&"hhY`&O"pB"HAF hCh;C`+"hhY`&O"pB hZ`W&6+@DhZ`W&1 hCh;C`+ "hhY`6hZ`HHKhpGhB` Kh) Khj3c1 i@ pGh(h pG pGh<"Kh2`Zh:Z`pGh<"-AFMFlF+h3+`0j  ,0j`bKZhB`h`h$hB`g+h;+`KKh3A[$p;"h<"l;"K-AhN,j3h'i33`@F+`D< + +KhiCah#`K$5bhZ`h`h`#hEob#``O02;i+j#h;#`+chZb`x-h+3h-h#+BF!@FHS"!@FH($H3h"`Za2hchQiWa Dc`F)F+ *!!h:`*;#`+#+p#.x+pK03`hKhC.pH`"`!`!)oh<" L#h;#`+chZb`xD#h;#`+ڽ@9h<"8 L J#hh`hRhaabhZ`#h`O3 ``#3ah<"FLFI#h3#`"!(FHN3hh(7hi`#O`a K"``#s`#h;#`3Kh@p;"kh<"l;"F-N!F3h33`H)H)FHxpCO)"# F*$C!" FH(F I$( FHH)F#" F#*C FHH)F FBH H9Fp3h;3`# Kh +p;"1l;"FLF#h3#` . O(F}`+ K^`#h;#`8``3Kh@Tp;"h<"l;"pNM4h+hh3+`(i#j˹#h F3`3h Jh`i`i[hQ`s`+h;+`KKh3p@pp;"h<"l;"KhpGpFNM3hBpBH&t<"I8ML+hB8t<"8FPM+hh(x+h`8KhB`pG%Jh%LcC$LehB5F"E p B2eF b`) )$O30 bhU%b)Ldp/0"Fbhc` @"5rOFSMhB%RKhRL(i hCOH!HD `0 hKI ` h (`GHFK"N '8F)*7/8FH `0HhB! D! ! 5O! H9hB H<0,>hR"F*H 9h h0;,.hC"F$H0H|hB 0FH0,h/"Fh h0, h!"F h! O3#`d! `! \`@"DB"Hq`@B"F0+fH2K2Hh2KaYC10N% !Ow3h33`B 0B(%K(Hh%KaYC103[h? ѻB5!0,h(ЋFH OpO5'; 3h;3`Kh@^Qh сBU`p2@"5rOp;"l;"8FM+hB+`Њ@! F]+h;+`3Kh8@ 8p;"l;"-OFFF 0hI FOqؠE`BԺ; F0#0%ݪph1FRFKhBE?  ++ +E :0+ї0+k8Fx0  BmnKnHhnKz@hZCB]а?\O B -" "!cJXFXF+Fh  3h^J!HFHF+Drh  Q=XIHFHFO +!FDXFch;c`+ FI#h"`!FG;3m># fW+" "=J!XFO#7J!HF5J!HF(OsB g "IFeshHF+fD(H  @IFV˱ch;c`+ F#hZ"` "pch;c`+ F#hZ"`|"pch;c`+ F#h6Z"` "p BFI FC@"5rO>HNUV`et0Fp@ճ DPh PU4mh-(FB! p$& F +; CC+OrB 0-OFFGKHH[h x%+c PFPFCAH+%@JQhB!h"D0ӱ Fkx+Ъx2-+%+++3K $i ,-HO)Fj'KZhSD(K!(Hh3000+ kxp?+YF8FL4F69FPFo(((F&pKC;Ԕ Z) "R,B4HH$z@"-C.N/HH3ic-M.O+h!hP0F#*H*H!O1h O A$H2yC130CE!Ch;C`+# hY` "p" F+hh"[h*`+  H 1hZ`@"&dD"5rOt'=F>F:H0s;D+7Hj(p(g(F'%0Khh[h .H!F`+Kh+KAYC1*H&0FF.)$H $N0B# kC H5X0hCh;C`+1h0 hBԿ # #P`p0;! KCX0hBԿ # #Q`.FdD"@"5rO<Ki !V(@B@"JiH#;pG2 pG pG@"KF60 Kh Khy Kh KZC200hI FpGDB"@"5rOB-GFKM+i+G?_#+a@F;@DO;h3;`(YOhp*Fkh",`O O1@"F:3k`;h;;`#3Kh Y0O! F;h3;`/K0;#0#63Os0h0p. pC;h;;`#Kh - F0 F40O QFF,<#F"EPFv2B03 *4t@"p;"l;"F?JFFh`=K>J` F F :K`/h..8KN0+A0˹GF)F G뮹1K)FhV0,h@RF*H0h!F 7!F 3!K60s!F +!F '!F #/K"a.!F !F 0+F(G H)FGV( I H.DB"d;"hO F!0F!H1F$к$ F {JF7h?!'T;shh*݀$! 9V-@.+"F0F h8A3C!F\JF(0T<0З0+!8F=F. F0FhiQK60+8F0^C0KВ?м<F X" ѯB!(F0F~s0 ;!KCX/J! > *(F_k]?cWF 2S) 1>0%-?; *5?2 *-(F"&$$ tD"xdD"|Z@"pFF3M+h3+`F 0/K1Fh0+Rhg@RF(HS!F 0+ #K$JhSCJRhB! FD! FPF& :(OrB+0+ F+h;+`#Kh 0Fp(OrB&6p;"@"5rOl;"1Kpi0HD0F -H%+H&140B#(M(hCh;C`+&*hhY` "p& Kh20+hOrFHH51hZ`M F+h3+` F1+h;+`F# Kh q Fp@"tp;"l;"HKhh@}&dD" FH h@p&8L0C1"B ۓPUP-H}(F#ca823 @"-G!fO F #F0.0>"#;F;+9jv UJ)#>;*;+\+"э0\#0"+рF;+Њ+؀+=+Yأ"Ҳ*o%H"0F7J JFFHF  0 CoCE Ё"#)J rF;OOaO}bF"0 +J$#"#I- K IJF%:#s*0 }+If0 w J$#] J"#Z*FX@"𵇰OFF,mi+j%h-$7]rEO""   XUM"hBJ!(F"hh:*+߀zHB`h!wHwHh.F`h!sHh%`h!oHoHmHdhh=޹ch˱iH hh!+heH-hcH`h!waH dh5F]H`h!gPH}YHzh!\hSJHpSHmh!ODHeOHOH``h!B>HXJHUh!78HMFHFHFHFhCDH@`h!AHAH7chh3DP[b8F F8H! Fs%chHdhpFN5KFa6 N0+$2$!aTi+ <."+*UZpp"pp$i"p@"-AFKFFFh|*/KN@L@0+@!F@FFx/KH S0#ZCO3AC`#r@1F@FDF$DB"-AFFF$8CFЀF:F1F(FA+>hRFH@F:F(F1F Ff-GF-l0 #0MN"LKO ZhKIKhh 3H30KEEI"hFFpA0+,#x+:"FF2x),/*72 FF>(""B#rڿ z&L F&L hCh;C`+5"hhY` "p"##  65S] :+хL#hBK*Fh F*#cU=FKh+FI FzhZ`@"H"H" xHB"@";"-AFkЀ-L'0 6P-9.9'K!h "$H(F#^0!JB'1/ܔ^0@60.0sH`7D((e 0F(Д^P- J/FhKBKA)F`@"F"px+B!M!+h3+`F!+h;+`#Kh ,+M@,`&#0@$#0 [ 0;#0#0p@I&Fpp;"l;"8!LF#h3#`F^( !`#h;#`S +8@'H)FKh+gp;"l;"8F F@-`h 8HqHg8F)0)FF F8L&M#hBڶ+h7FOw83+`bhFpC+`+h;+`#Kh +hh3+``#h#`+h;+`#Kh 8Fp;"l;"0I " F|7XJhh` D`KZh`hhB``Kh`ZhX`apGHB"pFMN+h3+`ph#hBchh`h3` K`+h;+`[ KhCp@hs`pp;"HB"l;" Li#h3#`KZ`#h;#`3Kh@p;"HB"l;"-G*L+Oj;h3;`3OIEk%3B-3h)0Fc`ch `#h```D00%`hB ;h;;`KhӱG@hh"DRi(FJFQFF*V#h`+D#`p;"l;"HB" J0 h3` KhD`h `h;`#Kh pGp;"l;"8L%h}#hJh[;(D`8HB"pMN,h3hh+hh3` DpHB"J hh`#D`J[`HB"-A$&FU{+@>`oCBH), D4C hp$r5UFF-8F ApG, 4S l)F@FDh(F)F-OK"M$` #HF0Kh+hHp/r/d/+hx,h#'.8$ F#!HGKdN(F_J#Fh2`$"  E(F.'L&h.@"h2"`FpL :&#hDE׀#zH"F|!h"(hwU(@_8F \\+˹ FE(ѝ J+)KEйIF&(:[HIF&~(@𻀼$hh2h(N:2`QHh:`*:[FF},Ѹ?wIHh:`*[FFkF e?c2h:2`* [FF $MyF sF A,I(h)F:2`*XF0.$J#5h2`#OrJ3h33`p"(h" " YF&(? HYF&? i <"tD"dD"^HB"I",M$A -A&wHfF(@030EFE0;0#kKh jKhh-|.u^r#5F0#5kDw" ,`5kDx" , O <^r#03F3jDw!%3jDx!3`kDOHF,\r# 06kDw",6kDx",;H #<6L h=#h[3H'8F&d/H!F+x0 *")FF@t0;޲.'H)Fw?BB+r H)F0(F30F@CF0F0;0# Kh !N*>hS)FF H@CEbl;"dD"dtzp;"-O$f%&FH[Fl00BфKhg [h˱HS/a/H/FF$=F vH)F.uIHF&)(qMHFF !;0_ ٓkHIF?zhHIFC 3Cz O0oAZF#`Bq ӫE U iFE*0_*hFUH.8&,ORLT <{QL h5#h[NH'8FiF ET<,T FH&oCB?6H-=H ! ! 4%4,##F F4HO4oELFMF!аE iFE"( *0hDF%HDE 0+ "@K`oCLB?Hcz ##F FHXodD"  9&d|Hԩ^~8A"Vp:*# p;;+pG8?  pG+B pG7#Fx0; + "(zB xZCO5ABAH!FH!F0R=x0; +?+ pG pG8F(FFI(F븱I"F(F눱, I(FP+x0; +(F@8 8 jp KqUy]"FFgy24Bl*Dq8LM6N+xñv@EEEEF,pEKI"F(FH8@80A" t-A FJMF(f);HH,F/`` 4<`^x-.ћx+FxB [x :+V;hRxh*<,Mѐ:2"F-H@`F%VF#F=`Թx:+ "F#H@`FO? I2FHf!FH$\xY:, 3 FI2FE3;`YFH"O F=h %3wF I"HF%(Fd18L&( F H K( Yyh)!`aYqK;lLD"\D"pFLcj x9ih px-)Yx)aYx-)ѝx-Њ3]xBRxF:*[xiah Ha( HVxP:. 2Fb%ebLD"-C [M Fih+}PhWHhx-*l4hbaih[h PHx-+0FD ,h$$+hB,ۣBDH8F*hAI h3 `Fh #FB"ӔF#FB#o #D4 B#DB#` h; `#-Kh 0FSLSLS B F.F+hBH$OFh+`:hF2:`$thYC+*;h`;;`+~ Kh+?yu+y  LD"p;"l;"p L M#hk+p+h&;+`+k"hk;coHB"BhF"h,#FZh:Z`F$hD`8FEhkC`+݈ #C"bZځ"h`8F !"Jhij`$F;  pGxɲ)ف+тF3۲ + pGxFI\pG\?+ pGғxFI\pG@ \=( pGғFKHhkpF FFa(FWh(F*KhB`KhB`p+x-+kxO3`HKhkku a8A"4A"-OaMF+h=?F:x[HZKZJZNhhh2`+fѹ?:xf*3h;3`+O FLKkhILK(hha\:*2`/ (F02h:2`*'+h3+`?F2h:+*_2`۹ +h3+`?Fњ&F"F2h:FF ДE-BFFYB ()h1)`h`C ( Q (|+h3+`Khh`sS"@FW *j,HB"KFhFlFi *џi8F';F (JJ"! F? F' Dn J3F!5 F K Jj-KJj*,?𵇰F FKhT*F! FKhBF'OY KD0+ѠF9 Si3SaFKD0+4F,-Gʰ F%Kh[hKh}K)Fh F6pK"!hZ`nKF`nJh3`+ F.gKhF(cK `cJh;`[+/%h-@ 5XKh ``Z`*`VM /h -hF+(!O0uMKh+;FKHO,hHKh00h3 0"``(FM (?\(A-3K9Hh00 (F;h3;`0h`[h["-0;0+\#;\(`($(0;0+[F;h3;`0h`FJh;`+#; Kh (VBF!HNF,FIYd;"p;"l;"HB"BKh#h+I=K"hZaD-%>(2##`00F`\b0 a)F(F(]0 Fbb00Fa0 (F@F|(#&(###`(%u<(>(%&(!##'#` `0 (j\`a0j-("``##F#*h{(2HK\BBK{*`O+h*h2*`OZpbh#(FWc}(FX5K\4L $h4@DM}(2FO (L Q*h_:*`*45"\F*h=#:*`*iF##` Si3SaM JVF0F0H58!M*hQaa` =+h$`2(*h Si3Sa+hh+hiHhH8 F"FepGChBhKFhpGCh hhBpGhD"F FFFch```v`FhFB(!H)!K7ih8FBȿ`%FF F9F FB!"FF(B! ' ! '!F'! '!F '1i*Fh FB{KXh8 pGD"F FF)OB@FBѰB0FBKhB` F)F0FB2B, 'h*F1FFH FBH#F*F1F-AFDh FOt`{h;{`-- FDFh(FB\h+Fh(D"pF N L5h#h(F3#`+h(F3`#h;#`3Khp@-pD"p;"l;" KpFhp.! F$heh-Шh(B-hD"KpFh FB`FBȿ`BFB#"!F(FCB 'h(FB0F"!FFH Fp88$Mkh +ܿ3k`@ , !bFB(+hB(`BK2Kb , $`8dgfffD"pFNh +JhBh !(FB KhB`B(FB Fp'h+ h +"!(F,FBv'h+D"8A"8F F (KEh``8D" KFS 0hBh` F@B̾FhD"JFhpGhBhD"-C@FhFF0 -0ܿ#KUh;+[ Pi IF0FB sK$`'0!Fh1FFoH0!B!  FBhKhB`-@;dKB 𰀲R #)F F/(x'h)FFYHiOr@!0FBRKV0+5i!0FBBFOr@!iFBz0'h FB'`?K"`'!hU1FF>HpCO FB'#`&iOr@aiOr@ !h.=0F20FO@ *F1FF)H - .0# 00;0# Kh ['#)F0F(h'jh*F!FF(FBF4F@3*"! FB&B"F;"vRl;"p;"pFF FXO0p @!FFH-! FBBF.'h! FBC .' h!!FFHK@CPp-AF"FFCF> OI2F8h0JKNFF3h8h[%I"F8hIAhB IBFhCI8h eIF,h$-$ 6,&$ȓ8 !MFhBfC Ѫh* b ! FB\E KhB`8 !R FBNA " ! FBFB" ! FB@CHpD"8F KhhBXhFhBch)FGhB0`8D"-OF F C 0 #C`FpKh``ܱ 0kKkJ`0jKhJ`h0BdKhB`3h F;+hB FF8 !FFXH! FB(&hF@ FCB(` FB Ffp+pxh!Fw(j! FB0300(  +7K! Fh0BF2BxCF'&h+ + +&h!FF*H ! FB\ &h+0"! FBPKhB`-"!(FBB*F!F8F/0;0#Kh <$030BF0Fvh-&Nh+D"4A"0:l;"8A"p;"-O%JNFXFF#U`3`9FJ F"A:3h-I(F6F(=ь,Կ##Wk.m0F=F0FF03x0+x+0F%(0Bc0B_iH1Fòs+v+fH-POF;++-+^H  PF%F1WHQF BPF%` C 2h"FI2` F#BF!4+hBCL h6#hXc-["! Fi@BF?up "O2Y*,&d#`&`ht!FF)HaO2"! FA"0F) " #"B! FA0&8hL!FFH?+#F! F.#BFHQ , M~'` mAr4A"~'8A"$F F)\ h;+X.O0+SZChֲ;C`+#hZ"`p+hlx<+Ѫh+h!Fl+h+;+(i!F>+Ѫh*I F+H!FH!Fh*ch;c`+ Ff#hZ"`-"p I F F$"8F&K,hh hrJhB1+K"`&t`8*Qh)Qh x),!" D" K60+,Kh0K`D"p;"l;"F F@}I FV0 F(O0lFP0J#FH !HH皞F"r8FYCh;C`+#hZ"` "p%(FIF FH -?- H!F?-8!%ch5;c`+ F#hZ"` "pȓ-A$MFO+h>3+` #;`+h;+` Kh{A3Y;3Yx#0YF4p;"D"l;" Jh`2FpGXX x3 pG pGD"FONF3h+L[h+Gx+ %%HKh+a/_-],R9,B,M3)djF F&:0\+L-`YBYA F&0O&DR-! FT<#>,33H&L#`"iF A3%$+%KN0+%!K6 Jh0+%K60+%%,%FKN *, Ф* ٓ603)ЩB! Ib #@R CBp+''.ـ5L.@/F4N , $,$[h6H3 F5F.HX --H%%4@,-(H$'/$-(HO R/L/O D0+?#H-DH0CH0FFH 燱|*xrD"p;"l;"xȓܖ ((,030 F,F OZhXhD@!0F0;0+Kh+?E/?t/nKh }(h(f,h#x-+cx+$.?]5'/?W%,F(l;"D"-CFK"`kONH $, -ѽCCY0Y0x3hAF33`x3h;3`#Kh 4D"D"p;"l;"pF LF#2 X,D2;+!(F&#2pD"KXmh+(x+ pG pGD"-C' L N131#rQ3@+1;1qUh-hFX24(FEAFF-(F +hF)D";"K? !8 pGD"8F M\2B ! ! ! \B8D"Ͱ#IK`a)8X)42d"AKAJd2`K ! *&#`" AfA!FA+P "@S  CC D";"d;"p;""K YD"8F I'!F F"D `]8 8BOrOA ؑ8 M Lh#h3#` #`k`#h;#`3Kh8@b8p;"l;"-AFF %FD'*F1F@FA- F7 /`&\h+O0hFhBа( R(cCch#`hc`0pF K`#C`CCCch;c`phMh+h3+`hc`` `+h;+`+Kh+3 Mh+hq`F3+`hc``0D `8G"p;"l;"8E F?C K[iB F8@ch;c`+ F#h*xY!`p8KiܿKYiֿFH!FDR]pGKRi]pG Os0 FFR ;B0!Dd#pH<0@pG-G F'!F!8sx+[I0F3\ch;c`+ F#h!F0FZ"`""pXch;c`+ F#hZ"`""p3x[HI0Fd7\0FzF(~ch;c`+ F#h'Z"`'"p=FO' O\ ch'3&+c` F#hZ"`ech;c`+ F#hZ"`'"p'K[iB FGU+c` F#hZ"`ch;c`+ F#hZ"`ch;c`+ F#hZ"`DZ5x-0F F(ch;c`+ Fz#hZ"`'"p'=FoؑKYi5HGK@@Fxr+ HHth-Ah h2xh+xB,K=!0FhKh0!=!F(F!@B!'F=++x;/0;0 =*+O%p=F)F0FAA%F/F5F&FpHB"ChL!2hJh F F HG"Fx B #` Of\ 3F[EB{]#@*`ғ-A("l DF: 0('FF?0F'`T;+Yhh)0X[-jh++iC(FG `4-hhD;dG"8Fx#8@HIF F$B H!F8@'+He,F#x+8'! F!&FH!F"FH-AFiFhFFKBh՘GF,մhF HAFH9FOF40=+sh-H F8hCh;C`+:hhY` "p8hCh;C`+ :hhY`,phZ`hZ`-OF*LFF0; #0% XkE"K)F!@=& qhղB uIA%`56h;FT ZFKHG"dG"C/ B=*Ѱ@ pG=* pG pG-AFFF F;;JU$ F=+@`'!O$7` KDi,hB Ѡh*FAFV.7`'F$hdG"HG"HKFy F!XDiF0FF(lChZ `0F#r!:HVg`h0F@4O:h2:`iRsq Ch!F00DGkh`Ѩhs*ikh2R"*a T##"#$TCKFBB0 ;h;;`Khӱ@ԺH$E $ Ty5Fh``p;"HG"l;"Kǰh!Kh@ K` K`G]K`"K`Bd;"\;"-AFF=!F HBF!FG(F%cBF+$t="+*U"Zp&41F('`(FA 0F#D;Kǰh!@#K`G]K`d;"8@L0`F KH-Fz0 I"#`0 KBF8@HHG"" t(O!0> h+;x-+8э0 Jh0"+Jhc"+Jhf"+J6i!Fl!I xp! s"+ H"iFp"( ] LD"`D";"0A")pF MF+h3+`T+h;+`sKh[p@`hP1F9$hpp;"l;"sM,hLH0h `#;0p@;h 0Fx0Fh"``kh#0Cc`h#a`5p HG"9%O-ѽ@ch"h2`Ԡhch F4h,5[ՠhch#@c``&FdG""FF BhiC՘G(h3DhFKFh(F"F!FgFرCh2CiՐGph4D gh)F8F<0=!8F!D F$hh;"-CO hFF+xr+'':H&FX7Khh޹А$0n,p,Ѹ&/(F-O&)Khh-#2F9F(F F/Ch H*F"$Ch;CC`0 h-!(Fnk\=+ 6&pCh#C`.:F1F(F.(FG(H)FudD">]F"FFChX)8M*h2*`q#c`+h;+`#Kh ! ! DRx I"8F^ch#c`chCb`ћԠhj"h F`d p;"l;" NO@#heh0m:hhH$hF FAh+Ѩh!"i:@hh0DGkhԨh&hk`h`#i+aHG"-A%.FFHFhKH7Ch>V Fv, e, f,Hx,%&%.FiC/0h)F6CsdD"(ܽ@(H" x-CFX FT030;x-+F!|xHM(h*hGI$f0t`3`0`;0+w?Kh+sC&"8FF=!8F F8F%A"h##3a%8FBwhBh`BB'B0(Բ` "i#2ac`h\=+#8F% KB 1\=+ 1#30"C0B)@)%!8F|ch+Cc`l;"HH"p;"HG"8F F8`h)FC$h8>HN(x(I($ H( M+h*`h@8DD$!FdD" hxxpG hFxxPxKxpGsF$~# "` FFF$rh{$nh"+ jfC2s3H!FjB JhF3x10Ix BH!F"F(F1Fp#o 40Ͱ FiF@ M0&(F@(6BB8BԿ  BA 0Ͱ FiF@x M0&(F@p(6BB8B  BA 0Ͱ FiF@R M0&(F@J(&BB*BB  F F@ I#\Ch @iBѤ5j@B!F@ؿ%hAFF(F@8W 3jB8FFxCx-*xKK"I#`~x K " I#+K" I# I#(H uȒpE0Fx F!+Cx+x8 '0(F(𗀰0+@𒀰P- - - -iF F@(X  x@ @ x8 F!@(=-c b#)/5bPbAFKbbbY^!hF<!!p@O  p@Op@_p@Op@_p@@Op@ O @+s @zB@ +x(+ #x)+kxbxC  O0RO0OpFFFF(𘀰0+@𓀰0;+z !*9HVdo)F F#@ {)F F#8 )F F#)F F#(Կ  FF(F FBB  FF(FFBB FF(F FBA FF(F FBA FF(F FBA FF(F FBA)F F)F F)F F0XcxO0p#x!+)F0FCv(++x)+kx+0x@ 8 FF#I h#X=!IT%#HD%-/00 chx@ 8_`hC0\xx!+B Ѐ(+x)+Sx+H HJLVFH!Khx KhHI3Fh ;"7 "F"TxJoECAoBAI"F 0?-OF F IP/eh~+x-+@kxl+^D+-+o8F F(@yJ8Fkxh320[_F(@>.pI#L(ܑOU;x%+8FF(@)hcH|O>@FHs+ѫx+KЯ]I8F#$F(8FF(PB8Fx5.+MJ+xh320Z(F](Fȿ,(F.h Fl0 FF AI"F ?H =K!h:H Uhx+N$z FB0p.?B>t$# "`8F"jBFx˹OBoCB?IH:FiF$bh#I!FPF?0 IO*hH?IF,,I!PF?C&o b|V6]0"K#J"x!KhFH"o 2-GFFF"MF@. HQF$&#+a,DQF H:F/D5D#HuH"VH"-O#N(F F3aeKhS#S`h%!'J!F(FFC ћKh-  L(ѷe=4#FS+`sa,FkNKhBh+ц\. " FOKFhCh;C`+ |KhhY`$ phZ`%.kx%+ѬrKhCh;C`+ nKhhY`%FphZ`kI F#\'*+7F;x.+{x|*+|7F^H)F<8F\IO6DXI F'O4{xxOxp غW غ%;Aڲ*KKH)FX +R# eeeeeeee      e eeeee eee e ee +R# %W e   4LF\xHF"\0aF\(ˁFO\ ps#;ppuaF1F"F(FH"` nv$(()Q ,(.&*Sb FXp'(\("(4 Y>o p Ff n r t v O\ OM ( ^#? pHpaF-#(@@^#a e a!F(F=F{pKikL h6"h0@*#I SzP`dO `I"dh PFd(x!#s#;ps `H#F2F)F40uL"yI#n`85D#5<"I+! "8F(FHBFHBF!xHAFch3DH b^5D {x?+-+H0#H 5Ch7FhhhH M)hq FF F)FFH0@>ڿkh 5H#D|-AFF:!II 40EI|F(x+=!F >I"F #\#dBj80]F@kR##cfF@kH##cdFjhK#I> #b#`t"pFFH>! G6[cc d`dBe f 8,">F(F> .#bpNF@kF8#bF@kF8#bf dH>=\80@FH>0j >kBRBckBcBl"rBbBd"bpGjF@#80#l#SC@s#d#b I>d(I |]tcI >R(I jnt lI >B(I Zot vh"phF F+x-+5 ##bKI # dȱhԢj* H)F 03h2`[hccH)FCh FG pqFFFF)h9%x--41hF F!rHh9h!9`kh C ;` 5 F!b0;h--rh CC68 FhJh@(F b8J8(F$( JD(FT(J<(F<(Ĝ\`8FL#h# ##`e`8@I") F2Bh:*J!HDH JM! 2-!+ٲFۿ@1^  ؿQp ) K^" 3,?","pJHHI"@I"pFM.h6FihH(`p!DH. H H!F0H!F+hD@I"\hx-OFFFF@F0Ft)FBFH,Fٹ HDбHAF~D'H9FxD HhM,qrk  ܀*+总퀺@@/@+@@+@R +@Xs+@^-ډHW,ij\+gnu+|H5h, s@  yhgh*@s+r@y@@/S++@++@h)ZHuh,(𸁸/@=NH%,MKH%,-@GHhx,c+@se+@^=HH=$+nw2mult{zH,  HH,s HH,-HH,(|H+{H{H,xHxH,uHuH,-rHrHqH*8,lHjHkH,gHgH,dHdH,z`H`H,s]H]H,lZHZH{,fS WHWHp,` SHSHe,Z PHPHZ,T LHLHO,NjIHIHE,G+FHFH;AEKD6,MAH?H@H),D>H>H ,>-?<:H%:->8H=8H-8 >5H5H+8A2H#"*)23;:BCIJQRYa`ghov~@CgK_KJiF8,S5*+5ѻ4к;ѹBѸI/O-U QO %;h+m-W PIHIHIHIH+8K,ٻDHBHCH?,ٺ@H@H5,ٹ=H=H+,ٸ:H:H!,8H8H, 6H6H,5H"L%h-(F7ch F 4\-J+Fd!,zh\:zB%J !O {h8F t 5\J !F  -@F%HF~ 7e 9@I"IFH Ng K!HK)FIH pPI"g sFF"# "`#x#+4 FF"h#I"F x+I3F"F (Fp^8Fx;#+MI F`8~+(Ѓh`PI" hh=FFFF "!F(Fv0`02hB" "h"++x#hx(иB K0h30@ O O o  HD Kh! ">CF"~h"+I > F`I" H" KXh! "CF"\h"+I  F`I"8FLh h#i{B I@L H JeE FcEFH"#%a#8`I"k+"8FL!h!I*F (F!N蠹 K"y`YaR`"(Z`bya ""`н8@ 48ԟ>`I"0Fh FxC H)F K #`0O3!H)F#`W|I"o-O}%  F/F& 0+0H)F^ jQF#@FOr~ 0'H)F~0F } F!JU#B 0+H)F4 s )$yh(($( F3KE,9/FB 0+ H*F)D@FG(݆BF F`I""Ph+ + + H]=+HH]=EHH5FpG7 FMjj*I I IkjB B I"F "FI 0`I"XO".Y8Fx 8 IF#\%+5#I#T(FF(\+" L J NFT; &TH1+FIb2FԢ*0g -CFhFx;H1FNK +`/O7/!Hx/)\0`@\CFT0P DD+`H1FW|I"`I"FaI"aHꢈ_H*_K_I`IH#j\IXHj[IUH"kYISHkXIPHbkVINH#akJCBSJSIHHRJH0aoPICHMJJ0+LI?HHJL0#II;HDJN0#FI7H@J#m#DI3H=JcmAI0H'0B +I )H@=U<+Ba#I+HU<1I2FHxU H&=I0F ":H:I0F FȹO3F;F@F ;h20HCF2F)FFP0,I0F FxO3F;F@F(;hT0"I0F F(CO3F;F@F(;h`0oRWbgI"3BI"I"_l`I"yI0F pFxO3F;F@Fh(;hX0FoI0F ZFO3F;F@FR(l;h\0/eI0F D cI0F >鈹"O3F;F@F6(P;hd0YI0F (鈹"OsF;F@F(9;hp0NI0F FOsF;F@F(";hr0DI0F FOsF;F@F( ;ht09I0F FOsF;F@F(;hv0/I0F FO3F;F@F(ݮ;hx0$I0F FO3F;F@F(Ʈ;h|0a_+sx+H2F)F0EH2F)FH#2F)F]*J)FHFtX 0 ,ĢSE?j)FHFc0SE?ZFI8 \+ZЙK#":bPF2\J3h20[@#PF;FF H)F4;hO!+@򰀇HRF)FDtHp#;`0 )FHFCE?(?֬)FHF8`CE?qH)FF4oH3 D@ "1F  |F8HN(Fp6 I(F K"1F(FS$4B |Kh@(&H+hJ0#IL WA(BI*F$(8H,K"g s-X6Qk<]|+hL0N #I B=x!I*F(H+hN0"mIC$hI*F(H+h#ebmI( I*F( H+hce M"@_~-OMFHDI8FAC(ФM.h.J{x+@4;x`+@0>x`0B)a 0O E `D0 CFh3ScE*FF J eI0(F"+(#nbBhI(FȹI""Hk0F1FF8F@kh+9F FG 5vJO R(F~(6ѡDi  F4kI (F C?qPkx+U+x`+Rو+x`0BLSa;RX[hDkBZH)F  ")FVH0|U*h  FPI  `A?3(@ЦikO a0 F[F??AH az"#)F F)kB9H)FO3B{ 0kAB{/H a(`"AF0*KRF*H!Fh=)K[h+?ޮ%FO3& BӮ Z B02F0!FH%#D659FH MTXs--d u,O"g Xo"h F0:*F`ڍiBhQ`p0pG0;,p FNIF:쪈 F*KKLILIS" 0KI" F(GI" F"!FEH8mCH!F0mAH!F*m[>H!F"!F :j;I Fj9I F*k8I Fk6I Fjk5I Fk3I FH 1I FJ /I FL -I FN +I F*m*I Fjm(I F'H!Fp#R ;#sX\5V/ FIB!FH Fp@;%D ,6BOVafo ;co4K-OFOFX 0F+a)cбk)`,[FFYFFPFYFdJ@! ` jhkFjFFFPFFUJ@!XFSI:F F*{ F!*NKOIOIn+{;ڲ*j+hLgLggagLggVggggLjhCI:FBKhk{11?I Fk)_hh:;IF FhhkBA!F+ }kjhKX DD$1IB FX 0hhDkB2!F+ d*H!F)O;5뉪hk{11$Ih Fk{11 IhI FJIk6!F* !F k,)!F* !F )O;)s|D 6 F FF & IN H!Fd0B F@;Q2F;F)F F6 pG@pG8Fh`Ȉ؀R[B@[(R[B@[шj FlFbjbkcHkXckckc@@BBHlXdHHJJLLNNmeHmXeTXEXTBElRuBD3l#J1C 1 f# 1 `# Q XC Q Rh"C B8Q 2BC Q 0(H.#B d2CI9(H2 FiB1o"hAE"0H)FROu-h@"0 H#h5;Dhs"md9s"||"-O}FFO  YH(ܣH }O9,  (Aa)@CKI"#(Ah H!#J9FHE観KOYhqFKOsArFH{K"*hX2Bb e@- <Epa"4) 0O  !)IpH "dK23DkH!?@s! D9F^J!aH?@s! D9FUJz 1TJK2+ }\QIi" F)FOH^*1+/2+1F=JFH H F)F20@?J?I@H+ؿF2J F1F2h| "F+F8H(D1*+2+ 0+b.J9F+H  F)F02CFF/F3FJQF H1F6"F+F.2Ct#2ohs"R< 6-<QE@!9XCJDIDH+ȿFCJ F1FBHQFAK2+p"JU!2B>4J3I4H+ؿF3J F1F3H|2+P2+K #)<;ҝ>0 )+"J1F%H^B0)+2J1F!HT+ E"+#*J1FHDK "#K J1FH2@F{A! {-F(I  6hs"m8DW`-AFAMF4bN (B1-h F5NE 5Nm1F*F+3HA91H1*F1F/H1*F1F+HG71*F1F'H1!1F$H@sD*F1*F1FH1*F1F?H1!1FH@sD*F1*F1FH1H*F?1FA9hs", 6 !4EWhy-OF-@F(i F3r0Bw0FO A+ u FI "jP зH 6 #QFXF( "U*_Ѭh /yd CW }Xr+@΀Bv J#F( T+ |Bv  @dEv$&F32 ( I Fu O ISFFUF$O O2ISFFUF$yO/yB? Ѭh dCTXBF #B? 2b2 +@k/13':F cHrC u+!##3F"FYHFaDEvFc+΀MKih B󜀺k V@FHKSF `B#c Bz(=H F K E| A 2$A$A 3vK'i&F"F"F9F3FY˹#R"F3F9FFHI "F3F9F>-?DCXPE  s"hs"y25ZFzX2[BBBBF F1FP@%\u j F/q` j82+}B,@KH(sЕxO 0O Oox@s9D#?Hp,2:F;4#FF8Hb(2?4#FF2HTy0pop9oy`pO@s(HD#9,2:F;4#FFH+(2?4#FFHqoq`q+?62+?1@h ! ^! Z0`hF Nki(iG3h8+ 33`l"-O$FFK'FBO`FB Oa F;@ J(@𝁂I$H F G(2h@Oa F8xH@O \F F#F9FqH +]/i+@i-T+@c=hIJFhHO NYh! b(FshOcCFc^I 8D00F F7xHFXKhCFKDEF x;62`vՠ  FKh.? ZFHF2F#` 0B ?3`#&Kz(F7 ?7H42&F&"""(>` $Vq-G FI#F7Os yFH)FHF7BFЗH(Fz*'8FґH!U*Ѫ)ЌHl"!4O3o{d 0g`#`'8F(ЁH9F)|`` }H01F* #aa0jcb"bk}icab*jabeyKFkH yBFfHw#iclCcdgl kj( +e*(0* dR\HWjHFjcbc+"h#cZC;F#k"hSCBBQH[i1FHFR7CKI"0FIIp"Fع1ù11U+і1+ і3S3;3U+і3+<8H8I OF(;5K'"hHF3`SS 310K13#kZC;F<#k"hSCBB (H0Fz2@Fz/1FHFR7RC'#k;1c1#d cckO "hHFZCSF ck"hSCQEB$Hd@*LhmrRRaAUAFHF7DBѕA0  O"A0bakO AHr  0B=HIFh  e0Fy@Fy(Fym4H1F%h ik)F@S23D f+H)F(HAFcjCbceBF#HjAF.clF e opBBdeH2F@sB KR#@r[OsBOr[HV1"#!e#ef$G_xF F hyF$H#k%"h8FZC+F"h#kSCBBH0Fy R1F8F6r#hCk8F!"l!"kZC+F"h#kSCBB HR1F8F6#hC0Fy(F稱LsFhFlF# Bd,`,n3f p  o3gK ,,mB  K J Fl H@2F`I (O3 +`",f-GFXFh FF (Fyv8`8H)FF h#@F UV*F3FlBB H/8hyfm@F"h9hZC6m"hSCB o-O$D FFx2mO@Fy/ FXyHAF(Fy5$ F BF!FT*xpikxBxLl(hOpEx(E(m $Aop@E=x(yѕѕ ѕ U, ,y,ly,Ѭy,(yyhy(yxLILHLI $lOrB.opBB-O 3mKE)(Fy8F'y`OpE op@E6H3Ibx/I3HZ$lOpO  B   op@BX+O @0FzPJFQFCFO 0FzPJFQFC QF`0FJF3m[ED٘ O 30FQFPZF;D  mC4! FH KH FpGHpGHpGEA<"-OFF FFO 'P0BHF !jE!2K P@F 3F8 2 6H9FZF5I ع#I 754  F9FZFF)H)I +j#b#%I2F(#j+bF F!H9FvI2F (I 3F9FsBFFHaI (I2F(#H FBF9FL I (I2FL =QpF$+mBpkhBыYl`Q`-AFF IFFJF0*F1F8F  I> *F;mB4X*O30`f-G"mFFBO %;mBHFHj j 3FO]hBZ`0V 0+ٜB؈b21QhBёh,F" FX,٣BRhB 5)2Fb 2 F)FF'HCF*F1F8FtI ,УB H"F)F BF)FHH#F)FpCF*F1F8FTIRFF  :mB!chSE =RF1F8FH#I e`tX,6p-OFm hF FF_C8FyeFHfH9F5O HF:F!#lfNci!ipp+pOsBopCB m!OzopLB8O FFhSEz(FyA+p!pj`OsBopCB &&l!F@F"r((Fy!&2F(FQFPFyOlY `REO.bEn2f2 px3lf"Cl1n2fFkFn2f1Bp3D`n2fN2 3,m@Fh"h f&3FBBHO w  f:F)F@F6Bo#-CF FFF%'#mB#kCkJ8'!lKD/^(F$0B' 0# 3+!,0( 9F*H+;F2F!FHFCF+ #IY0:F1F FE7nBH I C(n'c#mBn+ X+JHI +("m#BqXA#d!FHFCJ3@u{+7hO? OBڼB`\&knx05瘣"-OF7аFF_C1 ;D,3mBB  1Drh5nPFU3h#BF+FB@E:FPF6B#E#BFPF+FB@E H He ;:FPF6BB$Y"-OFFFVF+q+++H'I axBlJB@FJAIF1bRF+F`(AB-  H H ;B# /c"-A#NF/'e 3c~@F+FB5FAF|F$h,F ?",+F瘢"K OpxBh %pG"-OFp 1F /B+@ mB@$O3%F'F C 3D04 X0`3v0 #  BBОHi cO3=F BD00+; @+ [# X BB vH(1Osp 63rx*F*fHFFkHjI *(H(1" AF#(11&(?tB1۱"EDDD(1%DD#DspC(1@IK@!HJIH> +GI((1C(1D3{+@sxXF 3 #- =FF Or!XFWF{  +D; # ! SF ( ! ( ! !KB!HN5'0+?DHD-9';{ BB5? ;F/FF'UF  ;F/FFf" "Or!Fr2{ g3F!ϘB# (D {);Op3h( h'-?Ѯ -=F HF#!O3 1+FAFC%"qz ). D3spz  3 \zD OD= +8O p/@LopA0B_q}CC}Cc_0`o uOrYFO0O3  \--/׀ :Fs#AF  +FC?/ B1BЃHDD$!GSC@ BFH$I ^(5wDDvDL opC@FBuuu_#__/ P0BhC`^ `ñ(F FHI %(DD#D 0wwsw`I \ F(@Ҁ ! 1B?HFFH}I F(" 1 1v 1 3wL opCB"1su#1ui 1FCR/RBڲ B? ' ;F/FFRF'1SEG盹`I00h+?mFYHn%+P BRX2 2*BhB?R8F[XmFJH(Ff_FGHG^#EI }F(#spDDDy 3 J 1FX4)FF7H<F6H6I Y PDDwopCwDuw5wvL BOuuu`DD#I.(cP-]/h 1/?۱HFFHI DD qD7wvopCL Buwu%D3P4H#fh|fP !BHFFHI F 0 1D/FFyH/OrQFP( x rHCh55Sh03h0埱/#CHDDP0Bd0h_C`B(Fl$!;FFZHKZI ($q; www; ?w p#d0B)(FKFMH-MI g(d !$1%DEY @FO3Q_`#5# ;F/FFFi7K 5jB$DX+P0B?` =F HF#!O31AF +FC!D00ӹ  BB ]K*F5B$D$@I F}4f%"-C F#Fi?NOAEF@FxF08HAF HFxF(8Fx1HIFH8Fx@Fx+HdOr!clСk)#mB"H5 X( +!ShB khC`5 !縹H$I ^k" P  F H H "?c\/8!L5% %5! %F %%UUxx@U8YhZ`F F!YhZ`9F Fh)И`FF!h瘢"-CFNFF5F$ FU-28FU%JFi`AFC"-OFϰ F sIFFhqN55hoIE4nHv O dh E|fOO 5jnDB$5Z hnw (\H\ 5 !*$%+mBQITH"x2*$ 41:(hCCHF2#G+nW#BBGHjnHF 5knB EnOr!38Ff|CF;J !x#G8 jn0SC$1FF F  !^P HFC C 1v 1 vlopCB"1#u#1cu$1#w$1 cw&1w'1wL 0C 0#T#T#BBH]jnHF 5knB -`"jsȧ"L x# 5"KpGȧ"KhpGȧ"KhpGȧ"HRI 4 g -GFFFT5ILch!hHhS!hHt 9F0F-PFxIFHfch{ chS$h!FFHT pȧ"B~n R]pG R]pGHR]pG R} ,-C]$FiF?H$F@5*BfW6F0cbaXXSBBczgfp j $d$(^(,X,cWFH>HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOr F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"!KE" 0FlF@FhF8FdF/D#$B\5SEС.D"0BP%DDEDSC"B4 2F% R3BF F)D!F(4#h+%(FLI F :FF!kiF}~P.r# 0 #kD#c 1aq 19K !*q0E0 XF XF&c0Fa b,)оB*{ BF F(%k`(F1F 2v5Dbr 2#h%c+I F ":FFNiFUD0D# 0gKc紬":,""-GFf@Dz:"2,@4$4UB:ۡ@IFFEPFH0ӱPF zqilD J0hCJhC Fq "$""FF'F pchK x+`hF#BB' pch x+ `hFh(#BBРh(-AFFFFy)FFee0Fp9FCh`D`@FA-OFH M)pH2CnK hSw>C OsE0F)F(e %bO"j;h]kUC Fh 2O [br 2PF MVKh*F$SOFBiYQF[;hӈ[Ӏ# 0 #Rcs #*sO ;DO F#cF #爈  $oO`FFXFx0 F@C0[0chGF9&J0hC C*F0[02FYFF ki0DNF9h"i OR<Kih O0iFi# 0Y FFN"""""" "$"MFFFFH(!F(Fr 3F:F@AT -tK#BAH!F(FF( x I Kp@OFH Mج"logѫ7 FF0𵗰FFFX"!FhF#H0K7## Khr`hZhiF F o`o"(-OFq FFFnK#Bq𦀹v𠀑Ev X"!F(F:#H0_Knay88kd\Kh.`hd.~Рh(e.zRKOzJFSFPC ;Os.gJF C SF0FYF8k)F F@@ ;F @BF@A @F9F1KFIЀF-OP0   D !C! , s ڹ-U30RhC8 ; o{`oRJF C SF0FYFkBFF U#0+2 ج""""2C8 xF CcK0phOzOg)+  JJ  P C  @ C) CB|8u@5@DL0@:F|Ci+@ȀOTi! 0 gCiF+@ !ip 08hDkDB# 0vKh+m  )@ C EC{8%@5 Dl@CiF+gaI"i`H A^Kh+T]H,# 0B  ;hkZ## E!F(F jbb JnHDfj"FYFX7JhFfv5HV(,K*K0hOwOj%a  a@a8 6K"`L 4jF$ b ann@kf m""v"","-OFFFFBBp(Fq F`"##0[kZ##F uwKhwK)hO@g 'p :FO4p(FH@)9"#B0 FiK)F6 hgK *SF`0F` FFٱ0ZkBiF F)F!$%F F)FOrOsj"iZFKhi iIk DE" :Kh+Os#{+Cx!F "#F8F"HF/I"*KhD0FAFx+0FAFx+"F+F8F)F FbAFhh0F)FF F0)Fp F~x+x)FF FsAFG0FnC3C0FAFF@y0uPs`$"""""-OlMFF!X"(FF9F0F<IFIpCKHOF0F9F 0+XЯKh[2C ##; lM2HSAFC3CLP@! !H0kd#H0Kk`KF h!Phd h)F(eF##PoшH1H?(цK"`oPoH.0[L0" !#<F FRH !ȱuJh3`0rHP"#mH(ѱS  !F@8PXFQF0 + kp@OHRHRH(X" !L0#P?k H !`@"#q#H0YF;KPFk`(F1YFPF #C%Lx+-H3-K jP\: h 0F9FF#`bbbY0`b)FOpvc(H V"h""Lku#ch"-OFdFF0+dLKhkTF Aq (V(VCF80uF(}AKHFAF&hP>K(FhS"!`(C"@S f #3FF 2p(O zEغ $'O'N(M;h1hB8d1(hu+hk#H F87A?62O`^&0X5X6B?BV`+h;h(`d3;`3h*hY1`B#@"<"H"8"4"D"A"8F K Fh KhS" H*F#F(#BBh8<"H"`pN3hKMh,hC;+hB 0hu)(hu&#+`3`pT uH"4"D"K"h pGT"-OFH0$ FF+ ChGFPF $ K*j}(@N0k{0k_oFFFB"ZFX3FH1 F0#BAK(FhkKh+>ѻBiR# B#3 3"DFi  hE# 0K!Fhgjh~KB~Kh[oBWBUۣiO #aO hi)6R: Ih C O O kJOa(FaKhi "  \JhRoREWK!FhR* OYB*SJLKFi)HRhS0C""*BѕH0+oSkCK @@A`##>H A>uao0H/K"`S" :"V(FGFУi#aS":CF(F6a0 h3O 柰""""w,"(" h-O+]F# `KF h F 0CpG_ ]K Oh@(5BOpq۠Hh<*q+@-2C!FOrF2k@ T' AqF F3D2FKFZh@؀+Ҁ85@Ȁ@%D NrLIm r  @B @ +! C ""H*𦀸3+0cK"E@A`##^HE]H(SKhSKhFkxC/+uQHpQK"`75 /wEKhk 0AKh*z %k # h 8O kCOxav6Kh)y2Cy3F"FIFXFX?,K   7hZokC3XdDfn+?!F"F-, kQ2hR W狱 F 0XFG?}0hXFL""@","("(9ћH0+,v K"E@A`##HEH+(w@KhFTaOHK"`^:L=a8,""("lpFhe2-B+r3OB2py1`l2@ 8Flhal0dFx(F( KBs 8 ج"l$he2BB+r3B2  `8FF F0H F,-tX-K#BAR!F(F)MF)H)Kh+6+h`hsVph#H F!H Kh+FH+hF FH+hӱjy!8@FH2 o+h+`hiFH oi8ج""\""BFFF)/F1F.+J,Kp@OF)Hc'O>h&Hr&J1;A11H0+   #!F(FKh˱IOr(F:J#p@[H(;h+ I" K`og"Ȭ""h"*h","0F FH#z !F(F x) )H K+0#p#0@K-OhPF F x+$%F F)F $%؂&#Bu8#BB F)F0#ZFTFJFO hR Bs>V! .8 &^E(^F0Ft=FH F)FxF+4EYh!S FBĀXht|K F)Fh C `mFvI ,\5Bii(YCL|hġLsȱPFS08F .cK h*+_KzhB#B\HAFYK 2YHUK" zh F)FB5zm 0 #ACq#@ C 0;j;;b4$;4L3B2$ h:`ORX8Khj1Kh#F3# 0pCOг O?гO#3pi3aO  #34+?|!K9Fhs#3pKh8HO~K F)F 1KFXFwAC"ц#3pL"0"WT$"U " """ج""" Ox#e8* 0  Xm   +HH AFXFO[ @POh!'J13A1;#Kh+?>3sp8b(н Oxd80[m   +H HAF8a8baXFO[+KPfȬ""-O`FKF`h# `0I#F\Bii'MCCsh{MCszN(F0i F tJ3hh*ǀ+ǀqKbhB#BnH9F$X"!jKHFAF9fKhF*@h#**XXF ""X TKh*SIOrXF>HFAFeK#pX0+ #  cDJ1;A11,RbhHF9KAFB5{m 0 #ACq#0# 0#j3#b4$34L3B(L$hi2`ORd"Kihw3hiFBi&H ` `+?9 !Fi1oQtVd[I"mL"T"$""U "h"Ȭ"" "h""-OFsKFFqKPph9pJB-00 !!OO`   B{{ $XFDXC>A ,vڍP `GKhk 4)FX$ g sFFFF FBx+I3F*F p-OFLMF!hch##hHg1F(FSBP#h# MHH##r#hkhH1LHFHCM#is#hH,#}H'H2#h}H+=#h{H$2#hxH#hvHi3#hrH hpHt k"1 DB 2 ###hDT@OzsRF  E [Cs+FAl "#d!  #RF+FKF:FKH`ch+# 2ChcRC#R@ 0, br4Z0 J H DJzS80^Cf!8FD-JpF a` #RH#iKH%i-@ r#l+7H%l-@ f,ਬ"  ; Y |     # > `    JHch+x%%d%aedl(FhdORfhnononFn#p00#0 %IhjBPs#0#z0+(H'K"`l+?o#h$H0"HL(?_H)FNx !HB"I1@(?J#hH0r @#H>-h>#H6-hD@hs@5 ! "qR r   -OFH0v+zF3*sƀ*j8F1FF aJv^J1\A +q@#XHCXKh+sWHO@F+j F('J13A1`X(x s(@jK`HH(@g T ح"8""" *h"h","""" " $" "Ȭ"  _?y Ow)GтKh+CrI3;*s<ңn+9|Kj|Jh +hd0 (  F QFtH sKh[#rH 0#i$2FQFF(0r0ó dKh(%*:By5`I h<.y.* ! CIEGu -w ="'- Gfn*IEu *Xo=QC'D 0C##2K5Kh+? QFT#WF1HQ*0;#WF F(HQFz  jo   ˱40C##2 Kh+?b  T*SFHhTQ*0;# 4JF F H  ""$", "@ "@"g    ``Kh``O@V F ##p#Jh3` Sp03KhOsBFB~OrF g`gyK  0 0*G`hL*BРhP*=РmAFhM F ##H0Q0+E+haKh+XmXCC/XH#VHhUK"`#px o`o`n#eFKK h+ #OpC@s+hCKhZkSVsC3eDe)uѠnGumFB(4KF3N`p O h#H01 kKDF=2hi U +m!85@$@5DAqlRm@q # C AC7 0PѺEk0@FGՍ"""""L" ,"$""BB#eH7Kh;HM0FH0+?"##### H ( fI"F"zh"K!-O'LMKhjB2Qk'0HHDDLTNEpBu_X"!K% K K 0$jBaKK`0<\Bii!pCL FViLvIhLrsEr1 F F*FFB @Lp  3BL -#F*FECBs4EB  0!FnLkCF| #3\Bii%aCC FhgLCs F]Ki@Fh _J_Khh*J+J]Kh+MxpF3Kh3K`0jB00,QFFd pC3F'I"F&H&#0J"7Hq(5J"h*@6F $HF0(IOr;#q#q8`\'J0hC%J[y(3 #D@E:#hHfHg(?JF9F FV H""ج"H,"f$"8s"H3(?뮠 g!F _\F0F@FUJF9F F 24F3B2C;C#P pFFy3# DJE/#hkHH0 '}H;hc23B2xKhxHH;h 0#$0RF9F F &mH(;hc23B2gKhfH&;h&6#h   !F@F RF9F F hDF21F3B2C;Cy1('z./+q(HJ%FH%`_(bDK``z.(BJ3FA1>KBs;K#)9H<(@&2K"`(y+O h!gxFK+ !YY+#KF# KHh+Os##`#q(&J#*sԀ h2KIF#F@Fs^","ج"$"P"#*s)4WKh+@UKx+@TI h#IFF@FNH(F h!Fp@O##;pPxZ@I hO IF2FC)#*s-# P@A# h@AKFF FF+J Q+HL#Kh+2(H#*s##0۱y{xB hyK%IF+FF@F{xHq%(K&`{;{k H(F# #`c hPF H""',"6! -O|]lxK+4HHK"` / HH !m@"#FF8C ЪHBK`H(ЧKh3 !*@c̢"OK8hX"!n#`0K0>hBDӕKh*@>hBPOhBA ! |]HK|HZ(тHU(?{! jF @@wH0˱"v0"Ih -K! "$f`Ȯ"\h ! |! xN`pG FpKh+ZFHt!FH@"B? K0јBKBO0BKBKBKLHhIJ@EB##`` ``0#KBKBKB KHIh@CB K J$$`#`#TTT8 <"$""""T 8KJhhC\5JBK\5Kh;\5 JBK\5pG JB KJBK"H"T8 L"T 8hpF ` FChK`j bˆ6q26pp"200000000mekc#l+dme H3OrH3L3L3P3P3T3T3 *q*p " n)F Fp@-KhpF ` FChK`j bˆ6q26pp"200000000mekc00#l+dme H3OrH3L3L3P3P3T3T3 *q*p " \A\@P" |4a`h"44444 j 5b 5cnRkf0000P5P5H5H5cCncc)F Fp@-F:L F$h|@, L5+]K]KIhhB[hhBWiiBSPiYiBOjjBKkkBGPkYkBCѐkkB?ѐllB;llB7mmB3PmYmB/nnB+PnYnB'ѐnnB#PoYoBѐooBBBB \\5 ]KpG "K-OhL蒦Oa4??!ѡILOxHOS*FCFihhO1\0$іI  0F FFOQFFi(1F\(t0KhI Kx IK@BhB>~HW(@0zHI0nNiF&vOORi8h 609hi8hg81Kh+o0I/L8h!F.J0hC,JhC9hORi !hi0iF`iJ# 0 0K pD""""T"&<"E"8 "T"^t(""P"" "H"L" ""$" H;h-hn=F"E@FX+U?B9hAHK"-O, p$JO3F!FF`K-( dhpy)FFH$0!(F,K(`Lhpa)FFHhpC_БH)FH( , KLx+SЂJO3`#hHH)FXJ#`J#OOQOp`J 0a J 0a pOQaOppxIF`OQOppsJOQaFOpppJ`3йРlH!(F,VK(`_K"hhC)FdH1F(F`I0F,x]H1F}IKh *A J0FKF07 SJ `RJ`n=HMNJF+h\Bѓ0++h 5(&@5K"hh*`.]=HO06Os:K"hhC C)I X~CF(F h0/H)F0#,H)F*IxP)It('H)F`$H)FF!H)F ""4"L"_Օ T""r("""`"""P"$"("TD"#F8"i4щH)FцH)FpH)F 2zObPF1FXF#FFF|)R*Fd0wK0`7g\5SEC 1JFOsEqlbjH-(?\hO&jB0 \5SEii&hjn[@;`I(WjBVYKZJZIZK[H[K[K.IF"O3a!F(7 2y 0SB)F00(D[080;ZF XF~)F})BF#0F:F@Aq[@!69h4H|3H)h1NOR 5i#s 5 ,Kih*KhiFpi # 0&$Kh++h#H "K*hh +&L.DKh+g!hKJH)FF`[r("D"3Lm" "$""N"("FZT"hCMH$+h@b<^oRjO|DIBCk `"J` "BC:Nr wwDAGwC w`DvG *@ܰ *l0+@+h0+#h+'H)h0F0"!Wp0L%P%Or0#X30@FdYF)hOR  Kh#Fz)# 0Nج"$" """P""0+7#h+EHo)h"0P%ORc0#X30 TKhfKh#F/# 00+?W+h !1c#{H%H4(')hOR 5#c# 5 Kh)Kh#F# 0+h0+(نHH( )h#$OR0 xKhvKh#Fs# 0+hkc)'qHoH()h #ȁORc bKh`Kh#FG# 00[+hL%2@+hL%2@ł+hlkB0TH*hk[Bd#h+@PH( DOR)h |AKh?Kh#FVAJ# 0 0+hl[kB0"8"@"("`""LBALh "> z6H2;h+?Mi# F#qcq^# 0.K"`-K-Nh-K) OrOb`3h)H0-h(L 5s9#"F#p+Fb!K/k p0B!!p"H@S0hH #x%!@(FnK!`F(Fn~K`<0 "#pHܼ J#p` J`Jz@"""q ."," "0" Kh IpCO س_гOг_ KhK PBOг@OH $"" 4KpFh3H2I0FF t/Kx.Kh+-H1F,K p +KxD%Kx+)H1Fv p'M1F'Hn&H 2kh;k`+ H>IJ ,kh;k`+(F2 (y,Y, Y,+hZ*`x竉ռ+hZ*`x +n,N,稬"  T""!"U""!@g g pF KFFh H2F+F!F\Hk (p",! 3KOp-A$-`0K`0Khk9Fn-H-KOaaOp @anp(%K9F%NaO @ @af( F( m9FFOpnRF(,(Fn3h4Ean`+`5`]`O 0aѽ,+ѠFX"T""@!"`"د"-OFDKFFh 3%*FD:FBSF7H"FH:F!HF3H^OEFB "FSF9FHFF(@F IFFCs# B*K(Fh`JsB ) 3D@OsF FF H 0DD#H("\!a!! $"-OFFF8PZ3ZFDZfEK"`H2FCF$HE O+b9FJs# BB FHsH0DD"!! ("-CFMi Fu3K i3Oh2I#B9F0H#i%0F Pea#i*KBE)O,F.F:kL3B 0F#*FIFHFq8hkH$L4aCCsAn  @"C CH@IFhK0#*FIFHFK;h4kD;hPB("!&!"""$" 0}pG-AFIO hIn ;h 5C"3;`#CBBK!Fh H{h2F3{`+FihXe`a""""-A F MF I,hBdhBHd`  G C!BB$hiF F2 F`Z`+he`#`\`i,`Caد"""pF FF!X"hFhFep FhF)#  H0+  Kh[ H>##`  HF H(##` H7""&"."pF N Mi3h)h Kh32hi(hp@Np"L"$"K"`pG"8FL FTBA H Kh Kh #T0BXhH8ج"J"0""8-OFF FFFBB ѣ3C F@IO+HFAFx;+6I:F(FT"YF'pEEOHp7$)KF"iF38(F)F;FF /"G,B'F3C #0b9F(FO+ԹK1F FFKiF?#?;p<#4C0&e)f"\%ZK-CB}F F@𨀐0+)Th@O`m=(`OH$Ob!F LKhKH KKh+:JNL533hOOx)hFYOHhF Wq:F3hIFHFIiF"2 E[!;3h)hF:(h:FiFWp3h)hF-020204#k$ \3#j$ 4$bj04#8$j<@$ DH$OR#0L 5L53 #P50"0#"# }Tn""""$"F F\#IB?ѓ); Wp0b  L1WqOr]K+PEPE@@@ @ Or]KpGT-A0Kh+@CJ`L h(ڢKhA+PIKx+<ПKh+8ОM+h+QНHxKhKhKh+Oі0+KFOP=MOR1FiZKih0FkKh1F0F5iI h# 0TM& hO)FiMm h)Fim}h B9iB!H~H*(+h+Ф Z)F hi6m(FmEFpJ#]M`oJ`+h+EaO;h0?\N3h+5hH+h+59hSM#OR0ci #X4SKih8FQKh9F8FigCI h# 03hKPHHOH((`MKh#MH:LK6M"`OR8Kih9Kih0F7Kh1F0Fi3)I h# 0pkB6I 1Ka~Bs"#,!F`A@O E@Ҁ FIF\5!FHBii*XCAqKhXF{OAsD0HF uJ;hh*+rK B#BnHQF0 Ft vsaJ+F"_JC 00BO `0  +DFBO. NHO|2[Br2kLcB a0;02;B22shn;s`AO3IF7:MORi 7Kih0F1;h1F0Fi&0H `t F ` )F O  I  cD3[ED+?G IF>$0 $[$04[4hb  $[` F""TL"$""U Ь"" """KpFF @P%8 lG8 H/CiB iT%0PFaD%@ ap,"# KKi@P"0Bi@"0pGFiBiapG,"KFh 5p KBBB BB    "^F(-OFq h WF FFEx(APF!F(;Kh| @ci[E"YFwF 2B2#RC#CiKE K"IFhZ2B22[B2"0""pG-OFFkKMpF$S"0[\OC kBܽ#DJ4K'F[$ S$0kBB 'DX$@@HDH$[R7`Fn*#\(   [@²\@BZ @² @²IH(#Fn*"\@ Z\"@[\"\ACIHj4#Fn*"TX"@ \# T[""IH@D#Fn*"TX" \C T[""IHQ#-G F$F)@  nIIF&n*F +Ow\O ʿCCwTIF o$uQF E(FH! @TFDEB< `F N~8\"@aFqE:ܬIF2B:FU"D.E"U&E&, U$IF~{E$4IFF!B1Ri"-O}FFFFJFF(hI2F \(  eI@F&ZF` (F(F_I*F@F*80h+ZHIFXO0 }k6j`j`+k#akkcakakka@0#bB0cbklb*/}GI:F@F*0vBI*F@F*0;AIJF @IQF8"F F"F;I0F9I0F0 7I0F*5I0F$3I0Fh"F1I0FB,?/I00F"!8F1FHF*n0' 0BxBOЪ# (5D*#*#0w "F @ ]( ##d@edA#zd@v$#$[$$+$?$R$g$-CDM$OcFF!FFxCFO4 F DM"FF;FHFF(F)|,0 12-O]F0{$1FFFF@*B۳hrpC`_@/!@FCxr+^#`OO4shlХuhh*,O4JOaV!FBV` `(sѥs1F`*(ۥx(3h/8F1FO sh*jF(gѳhpCOT {0_JOaXFhXF*OF,1F F*(/R F)(۸sO ""`LJ;F! @ "!)lFI*j(Qh+` F7)4H|O_I!)\F'FOr@!O)N_FF#BBХs fXh1F($`x%|#3 F( 0I F*OI F*(ۥshlUb## F ] F)$FF F@Kh @pG$"KhpG$"-GFA2̢rOR5O 0YhPrJ#h[D#xH(,%2 %%K&HIFKh+𰀇H(6#hI"h AHIF&}H{ JFFFpAO #hsH##JFn "XF#J"hkB Yi)="hD R50JhC]HIFFVKh+XZH h9F'#hT "#F#hkB Zi*ALHKIiKHKIFhByB XyBوBB?HIF# i#aJ:H(M8K"` 6H(3Kh+82F&ks*K`F)K BX(LO3 h 8F (рE v(# B} i#a a"%"%%!&f&x&$"^FF^G&*,""ȶ"UY."!h. (F k !O 0 k}UK!"I&YE 6Y&`O 1 @  8F (C 0u +O )F!k4FFR9I! BL6JhQ#\ A41H 0+3/H *7( C  iD k YCLq B i!a`4I H(K` 308FkZC 0kB Si# H FFȶ"&,"&"-GhEL@EM+h#ABJ@Jh"#F\+hkB]ie6H!F_ .3L2Ji&ܠ p4FE АBi#aA"F8F4+   S%@ 5#AFH###bi,0H#8F###bio($i H( K` a".""x&0"&& ',"["8M+h %3JLBH#h 8# #CH +h##CH #h+H H( z  "^F"'.'D'  )%pG-GFvFFFIF(F:F3FF8FO`f#TD&O` FB`۽#D# 6P I-GF4FFF%! F@F :KJOF#` #q  J# #!F# F :F @m# :F^^F: p FFFn2Fg2F`2FY2FRppFF F((*Fmep-AATB A ҅BAӃ Bt ҅BA E|   Akk@P!ABBh-OFF"iFF%@B7K@J17J7H iiBv FF!jF  ]E#  'XF@XC1FBYFHFbh vDUD#i  'XF@XC!FC)FHFbh7FYGBv+F7F7Z'̱'i!@BK@}1JH 5cEu.FF>FpdF qE  .FF FEBv F5F5Z'ܱ'pF%ckBӮk+K@,1JH ;ch BhZ`Bh`k|#kY(5k#K@21Jp'''jFKh[H*jkX# Fb#`k3K@!JH k@kD̶"'''jF3K@AJH @mk) F@k$''-OF-FF# -Nе?9+$+F $<<_<(FkE*F!0 x#k4`"vPF ck0 v 2BB & ,PFvF,PWK)hB3B;BRHO$PFFyPFPFXF0O OshBihPFv#BB;H& FiA B43BFOL IAQ RPFIYqBB%K@ 1%J(AFPF6I  #j`40`@00 S"`H`C"80380̶"(LBAWR(t(('~((9NBAW()(L0O/FOs hBgi&0FBB47BFOL Y AQ PFI80+(K@1(J;80h BhZ`Bh`k*6I hPSPTvkT@h(?P0DjT`F>O1F 0FkP`hT@ h3DP0O '^-GO CiFF j3K@FQJH $O0$jFFkkCE0Fk F+kS(p#1F(F#JFVF(#IF0F#RFF(?h(p'-AFCi&F@jF3KOVaJH 1F FY K@aQJ:FCF(F (, F$('#)-CFCi& F@jFF3K@qQJH 1F(FQK@sQJ4DI "FKF8F(#AF8F#kF2F(F(F('#)K-sCFh F N3hBF HKFBF0hKF!F p̶"":)K-sCFh F N3hBF HKFBF0hKF!FH p̶""k)KpxMIHN$+hmBp(hPHH( (hS2hR[m HS4Rh4T"ж")̶") )L h@j . hY##`ж"7FHh(j,)F0 Fж"8F FKhñmJh K@"h`B #BB  8@n "$""oKsh;+nKԿO@bO`b`kM+h Et`) fHofH~(W :a)7)5`H^]Hm(]Hd)h\LOR 5i#s 5#d3#a3NTKih`RKhiF*i# 0#$F !$p#x3.h e2#F FBH!H@H9H)h8LOR 5i#s 5#d3 2Kih0KhiFi# 0$*hd3+6Y)6ؒaqK+-HH(?k!HL)h#ORa3d3iKihKhiFi]# 0$+ FpHF第"̶""* T*9*" "$"ж"p***I"@ #-OF3FKF   h3SB/F=FѴJAF0FCF"ѱO;hB&(_# F#O3 #$??FFS jdt-h- a-7b-$НI FVi +R#tCtCttCtCtCtCtCtCttt F0 F Fp FF#F ;hBЫ F ##F8mBrI2F F(F5.q FF9iI2F F1F F F)6mBmB^I F7FFF0 F0UIs$$#XF # FFII# F FBI @ P :FcF2KEB FB22B;B2 28$"PF Fi0?n1F F @ FFcF2KEB FB00[@;@0 08$"PFe F@0??J!HF#I F%###rKF8(*` **+)+=+{++-CF jF FF&PNEBF)F F *F!FkCc8FC2F)F F6k#c#-O < F FF3`0 b/5A/7L/.ЬI j]jZO0c/i/1F(F0ТJIF FCFџKhBЛI o(FAF(F=#H4pCO#,FO  F  3h 0h! F,F2C-ЁI FWB#ѠI:(\03h+bd ^ $oF( Fyj kHD D fI F&(0F&j+3x/+0F3F_J`I`(#$jFYI!HF' FUI3'47jVNI P IF'0!r C OsFI FOr1F'p0B F>I'Or1F 0Fj^ @3(!B FtF.IAi+6ii+ *fКBSi F$w;F0?+$;F  F0? AF FC0IBBUI2F FB FIJ ,` ,zd@4,S,I,v,,,,,-2-+0j$!m#80 (њ+#Z ИBB#BREz-O%-FFF.FF WJAF8FfC # SKhB FFF F!H6KI Ff(A(P(FI ) p( F0O0 &O %#a! FF(@џ/"# FC0IO "# FAF*IIFOr npJU#BF1;F#"# Fj}F FM0I FBF F;F?? Ft0E Ft0O0 -` -ز----CFFFO 6J9F0FCF3KhB! F!F F!F FF6(I F%f-r-нC #IbO I$$! AF F0I%(Fn$$!0j 1F F0I/$$!8j 9F F0I-` ..:.W.s.I"@ FFFF4[ IFH$ I"F H H:F1FZ5*FI@H'񊾽@ I'ľBg EF# F*sO0pN "0hF(qx+S+ Sx$$3 B+Sx0h(##~'DLO2BC;S@۲T#0"-GFOE$0@T+O%F+KE#3p0 OD  XOo7фD \O/  E d4p?datpp) EQULFeFo EҌ ?d?a4pqpOq-A8$O~&F#F-/L]!B"! F+$+F+$+$+F]!`B7$4<?Ѷ?C Eҵ @=EXE!P C\C0cFFOv!p5BӰO4-GF$F F0FiF# DRF#F BPE(Fj%(F2F)F'FB-CF$4Fh'!UJF+F BHEO01jBF'@E48FC4#RB]pG3FS[ Lhja)FF F+0@pGF04[ Hl ]pGB-O!FFFWF@nI(FO0'kI"&ih a F\B 4+dIBF;F(F Fj@ 2$PF 0) F (F#Fh0+4+#(FOIQF$m4B +#(FHIHFj+6 VBI(F AJAJoVO(FB ##"##BF;F3(VO ##F(F# F(?l>C? ifm0FR 7!3G 4g+J3F!#(FI##j(F#(?3a#mCEؿOF...../..4/-O!FFFWF0oI FO0!JU#B4+hI2F;F F(FiI #pFA\)#32*V6+)YI"# F#"S F###"#m((Fi ԫ4+II2F;F F4+DI"# FvBI2F;F FJ#"S F##2F;F9(xs0s+ P [ /I2F;F F#Eр$* ,! FQ$I20*+rO FOG(?Aha3` JY HFQFFF F0$.`/|//////-GFF OaFiF8qԋH)F$#tgd@G#!$4###F84(FOcuF3)FOb FHsI FC& FnI Fi a'v0iIH4$pCO,иcI$B'd0_I$4#^I FLWeV@ZIb'L0VIWeV0TII4Os$4FWeVdBFT#0F)F LC DIBF F r#`GeI4$#0F)FRF 2(FqFFF F F4In4K2F0I+F FBF;F F0?Z"# F#% 0?L"# FB?Cȱ! Fбj#R BEs F0?, F2g#0+0170d@C0Z0d@q00000F4BB* I'0 I F|4 I"F F@'d@1=1!F(I FI ! F  I! F! F4I4j111-AF jFjF&1YCh&ae FAF a(F0I(FO09F(F0I0F12$ʿ$ Ŀ9!+OտOs Fp!Ap!AOaOq!pGjXm j0pG$4jjPm0pG $4jjPm0pG-G FxF(B F 4IF(F 6갹N*F;h%IH#h3FEEO0HN RFW%05IH#hc KrW%02F I5H#hhEE%&(2g 2=2a$$#Q ~8a#*N FsF7hICO08F(2h I(F4#*#s2hI ~'T2p22-OF hF# F*OUsڋj k#*s /BO0 0F(0FF (Fi+Zi)WУj BS(srBBG(srBB;90FIF0F# XFX"AFPFG0F0IF0F"AFG0F0ck0Fi I 80$!m#NFXF (-i"QFXF(2FFFFO0"1FG Fk0 4"1FjG Ff0 FzkIo 2-CF F uFCI9O0F$d#HFAF2F `CIJFCF F"2F#8F)F PFFCFFI:F+F/upFaF222-OKF Fx OIhzF@FO O !FV |`   I"F8FO8ND#C C#I NF~'+3pFN$3i)FV+HNI#@ BS";I(F2*8J@!8H6K*<* ;+J2Kc:F#(FF   (F0?z(F0?t!@"v0F #0FAF(Fq0I(FYK 8H#1Fj#sD?C3 s6 $@;` ;ȸܸ< <X8&<O;"B<-AF)OHhFO NON F=FHI2F F8O0 F0I2F FI;F2FJ(FZ4R4$K?K[K-GF F07- d41HOF1j$$j f0j#h(F##&##.a#(a F0I:F FO03F FOhF FIKF:F0FR4zKZ4K)-OFgI OYFF F!q@`I FO0! Fc! F]!  FW! FQ4# $ NI)|(@JI籱H$ 4"#!+#!f F0ѹ("#!竱! FF(OO O "# F"C 1I*F3F! F0ѓO "# FF'IAFOr pJU#*F13F2#" F#yF F0I F_I F" [+j#BB?~  IF FG+ьKKL---fL3LPKpF FF M    J1F(F CF KhB J#iF F iF F80I pLL` KSB@pG#-OFF F   b-V F,wJ9F0FCFtKhBQ+s F0'`i+Mi+JaBBD # F# #??FF* F < 3 F FhVI"dTIJF Fq-  FR0LI aF(F#i$$#XFQF4  FF&@I FiE6ihhw2BE[  лz  #C %*I F BF1F F ;F??FF2BB2 A:B; F 0  F0?x F# I#JFL` 3M0MQM-OgFW#F F##J1F(FC ѭKhBЬI q( s("F F0O0## F#"#??FFEA6U#I F!W#$$NGa@Eq  s*FI3F F ! F Z ЁI F! Fj {I! FwI4! Fjj Zj #!  F $ (kI F !BBeI F a# E f EyYI*F3FyXI"@F 8 EyFF a EyKI B A-v B A ))9+FN>. I"R>H$J!>8>Hm#8$!FHH #RH ^OaOOO6OaQQ PP𵽰 FFBg( ;-579ZyLH=@$־VIHHH>CѮ1kF  !@J?H==H8:H:H:H2C0H7H#jT!p RD EB810)-H-Hzh $!8m#jFiF'HJ!#F J H\1+є1+HFH=@$THJ)FH=@$C(P/P-9P?PNP^PlPzPPPPP-PP&\ Kn:f*oB (КmQeppGI$Q@g g F]{JF zHzJ wHxH(FvKuOFF ]#8F # 8F i.1FfH#!#"ji &j_J!"3F!\JB3FB" XI""WH"i+Nр!TKPJBRHBBQHPH$ O O@#3! (1$4! @H^ Im#8$!:HP9HN #R6H&$ifB-H@(JB!S"H4bOa)H*#1F#"ji> i+;+#j83J"!+"H #jc d 1bb PPPPPPT"Q@QkQN4QQPT&𵇰FF F$]J9F0FBZKhB"!(FWH#9!F(F l( `(a8 (    "u(x(II NDD(F0(FDDD+s(F!Xi+icvBB)(Fi)J )HT(J &HN&H,(F$K$OFF.#8F 8 #8F2  iH&  #!F#2ji5 6i HQ` Q PPPP!RV-APFF FnFC 1K   h3SB7F>F'K'JAF(FCFı!I"hFh!KhB JkF F"i*T* L*I ca+, F0l*ТsH O0iF FN0@RMR` :Q+B@+pG#𵉰F F F /J1F(F(C(+s F!`i+Ei+BvBB<ԱKhB# F#"#D)a8 (!$I  F~0, F3, FH iR` :h `Èˀz rF /0 //B/pG-OFhF F 4689 : ۉ>0sxs+4sxl+*O& "8F\&K(D" F3*FYiC2ѝ?0)FJ F >0=0<0;0:0 K'F " * h J# F#*FiB73/ѭ67.ѿ$R-C FFx[PD FIF[  7#I"F 6 5  3 2 1  . T (T'EF1F&먹#S˄0 00**+7/O0S$pFL&{@!J 6 {c{#{zzcz#z#h  4G. p$RpFL%#1FH4=p$QSpFL#FD F5`ir)Fp@Lp$-A FF(?4;;J044rABOA64N  #38NC0 C8dCS00hF)F#@c0n HO#CFI FO0'F:FAF0F#I F0F#IBI;F FD0F#0 CC0瀜S؀N`SzSSS FFF(,I@ǿPC 'K #    !J1F(FCFKhB#JkF F@JkF FU*L* F0a)K@I  K9FhZ0 VV` ٺ ~' FFIhK8SB@d"FFRKh JS BB KSB@Iht"-OKFN FFJ)F F2F3 ѠKhB ПI ?Oo+3hFF($$*ڕK!JHI`(XHFrF8FLF(M8FI((ʁIF(@ÁHFI(Ff)2i;+/F4jOswI"FrOF1+F8pIZFP(FzmIHFH8Fr!(FhIl(Д!(FeId(Д!(FbI\(Д!(F_IT(Д!(F\IL(Д!(FYID(Д!(FVI<(Д!(FSI4(д!(FPI,(д!(FMI$(д!(FJI(д!(FGI(иѠF()F@F(  4r :IRF8F(?|6i$6IBFPF(q5jH1IhF0,?f Fa,J!8Y)I F(*m*%K!%J%I F*(#I"F~'lV` oVVV,R/WVVV\VVVVWW!W-@WJWSWXW!+WF(?Fб5jO h$3j3BAIRF@F0?IBF\F @FNPFpO8K!8Jm8IZF(6J!+F4I F(0J!.I Fr(# F*I( # F'I( # F$I(m#8$!0K!FPF(  5I F>(ўL!F(FKB F(Ffa#?WWW R\SW WWg -OF-FMFO J9F0FF3 ѢKhBСI ;OļF+i+ћKhO c! F$Sg(`ђI FU;! F(! F0чI#aI(FK((FF8FII(I$$#8}I FPFHzIPFF(wI(O2#X8 FrI(F.pI (F($ YFOYFF  fI (F:( FH F_I%(Ff9FBF0FGPFa  TIc;C3 (MI(Р@F(?}(F*F(F,$ eF(<@I F>I (?` (9I"(6I0Fj(?K3I0Fb(?CBsB r)I FZ"#??G!I FVoF)F#$4B9IW` ~'WKWWV/WXWJW4X!+SWPXWWX\ WtXXX6B$4&!??ѸI^BBٶIPFF(?I(?OrF(FZF?J+F8 hQhO39/bkb 6+c kcˌ"## AF +e#keIFe(F3F(a$$x??"Iz$$)F"$4BIFa(Fa.addh$4's(aJ?? IL$$)F"h$4BHY.fYYpF" FhF!Lih"hFohh3SB*FF xC J I IjF#d0 I |8 $p0Y'iY!!pF-PF!Ұ#.2### C## #@# 0"K,"'K(K)K*K+K,1F(F  Rpi@YiY!iYPFxhFM B]HKpFx +@DJhx Bxm5@C0=I @@Bt:H AH ix J#@;@BO6F.H1F.h`i# Bx3@C0"I @@B@"H A6 iFH h`i# Bx3@C^0I @@BH AiOaJ#p H  p"("&YZ ZZ$ZQZsF J INBI F"(FF$0pah(Fph[x+ F0h`hh $h>\ZiCh/hB(F#E-OFFC BFxJxI (F7FsJtIFbh hQFhhoI(F(9ОlI(FF(HiI(FFFfI(FFFbI (FF(1Ѣn# (F0%NJUISI (F(0+ѡn)|"l0F"z0onJIXF#  ***ѻ YF[ kױ:I9IRF \(AF4I R꯱09F=C"l0Fn"4"l0F!n".0bnl)lckB(F~th1+#o˱!F(FG0mI, "l0F!n"0k0Fm"0m}HY\Z>pZtZ|ZZZZZZ-AFF$ F8FPF F(F:F 1FF8FF(AF F`( F$(F*,I]-AFFIjFFF+ CFO0&8FF(А"!F>"9Fo I0F"l0н #FI@F*ZiF0 F@ FF:F0#`O0BF?#8F"FF(F2(! FFFF0v#`O0BFj?#8F"FF(Fh2(! FjFI@R#`O0]ʾpF.IjFF(,K!,J,H,I F8FŔ1)9XBaA;@!F8FI0FhF(F`I Fĕ! IFF0FLF F-O0pCZ[X[E[i0,MPI"FD  0#i7" Oa2J oN+x7#ci Oa 2Jo@#xc ,M0)F H(F0D!FH F0DiO[[[pIF F (KV!JH FlFFh3SB"FF IjF(FT0I (pE[[e[i[F"!hFIjF F2C&iIFjF0KOaJHI FC!0)PBaA:@ I F00O0 &C[[ \iisF FIjFCF0F$|0K@QJH FFI x1F JI I(F&J I Fe pF\[+\P\b\tZ|\7 F F0J IlI(F:F0 K@A J H40 F I KF80:Z\\\tZpZ7 F F0J I40 I  I(FF0 K@1J HI F80IZ\|Z\\pIF@0I V0dFI`I(F"(0I2%BȿB Fd  H1F5xi b]{]]sFFQF` 1F FU0I*F  FBCXBXA ]pFIFFXFĕ pIjF(FmFĕ !hFIFF0F^F(F`avi p FIjFF0K@fAJH!F(F0O0 p2*^BbB;B2@ @e !F(F I FF(F`C C][X\a8FQICF(F$<0 K@1 J H6&) F5I Td 8>\b\P\jF IF8v#`O0" F~0IH: ]lHn ] IFjF0 K@A J H I F+0H &^[z\i^ IFjF0 K@A J H I F0H &&^[\i*^I#jF3I %]i ] FI~F0K@1JHvI F.8\\\tZF08 (٣a*أWA*أ=#`O0P IC C #0I b ]iH]رL ! !^n J H` "FIH&6^B^xFF J Im!HONL!(>FHKI"F(;FH3FKlƹm!HJKIDD(F"F H(F zsh(FG6hT^&H^N^o^g _A`pGA`pGA`pGA`pGJF `l `dpGJF `Qm `SepGJF `m `epGJF `Ql `SdpGJF aQn `3SfpG8FFH^0#`O080 +$ A;+#M(F>( #,T CK \"JFnpG BЀi-OTNK @@ D`!Oy0FI 6Q DJgI B7I DD@uAvB;L5FD0Z7IFF'FF%F&FF 0KXxF Ai)i+8@ U,BB" B@FG(!!@0 !20#KEB SEI BA@FG(By @F@`ɚ;6ei`"-O]FFwEF 3FF{AFјJI O IF AF F*FFJI+OaJ$n#on9FH"9F(FnI*F0F!@0#цH)Ff"9F(FnI*F0F!00)iH 0 .AFZF FD0 oJxI)i)vH#R:Xh"9F(FnmI*F0Fka@#+a!iihH! Fj"9F(Fn#"bI#0F*Fa!0Yhicj#F(@ZI :!#nWJOao z0۹:##nOa z#LJo0+QFIHН9' 8N@CF4@C2Fy. &I@FI(8F,###p(,""p])hcNH#F DI("Ki1ibI"m0I  IiKipF NM3hB3(hp(h$ F"! C(`F4`($X"-OF(pFhFF_x0+(8ICx h310x+ 5 3K2JF,xT!FPF-K,J5 Bݒ!HFj`'痱ha0ix10H%(FEHH7h 50IJDh!LX1 XW90\ I@O0<h0@W< C K5o o niii)pF F'x0+$JCxh320x+H&Bpb\20 V1CB"FQ H)Fp@ Kh#FH]6Ho iio 8pP( FC C (7L%#`(Fp"#, ۴O,F!(FoA\ @T`bYF(2F K"#F FFCF I 8FFI"(Fl<*F1F F@ Y`ZpF FF!"hFTjF)F F$p-OD]FF ?J?I  }?F9J:I  PF|04J6IOr!(F""1F(F @<` D]ah0FFhKx+ё0 x+"OC+a*F@FyIka *0IHP$hk|KEћ0Ohx[s@C(ѝ<1O+ K I HFx\ZYiiizii("pFHx FCF 2h++ &pI "!hF"1FhFlb"x!F*(" IjF(F0 h1+h/+Hi iiKx;@FH ." jF FF Fgh(F9F$hhKxB8F( IH g jP A F FFCF I jI"( J+yh320[ I"F0F0O0 O0Ej@jo :i"F0J IDIjF F8t#`O0 I F0z0I ( hjtj9i|j"F0J II F48>#`O0 "xKI F($0 I F50I Yjtj9i|j"C0н0]#H0JjjpGh JB ~BB I H JBFpG JB IH J HpG HpG HpGPP&ejPPjjjjhJB~BBrB I H JBFpG JB IH J HpG HpG HpG HpG&ejjjjjj-CEDGFF FF(FB:FIF0F=F 9^), "FI0F< 9d%B 5/ IEtBӨE0F=KhsQCi"IF&0I I  F 0KOqJH0 F I CF H F$ijj[PkiHkPI FC   C #EC J I I F0I p_XkijkIFjFP0KOqJHVI F0 I v I F0 I zk[ikijiHk-CEI OsF0AJ AI:@H # #%Ss #ccb@0O3a#bb#c2I"F0FJ0S0I /H "P"@+J x%ahY2 'Bx:*$0%O 0;ca"IEP,#`O0a 5 -x+I %CF:F!(+F"3a+Ѥ p}kki8kko k#I Ff0JI LFIhjF I F00I pkkilIHԽg lF-PIð2"F0:69Ԛ9o&&PI .(F$ !( * , . 0 |0𦀝l * pI &&&lHl m."gI(F#`030нb0+aHr^I(F#`0!0нb0+wYHbVI(F #`00нb@)BjQHNLI(FI#`00нb@)B_HH02$+*y0/H8i(illilmm*mi8iiihm"lm$m3m:mBm),.,C0C**+-H xh300[Kx:+* 'H" &H!Fn&$'i) Hd.??7/?;, 4i{HR;HL /HDF$FH6OsB H. 1o kHmLmXm|rm|m0 I$jF%DED D D0I(F F0i8kP  IjFM C0I v ]il IF0 KOq J H2 I F0I R p[kimpF FFHF0FE< &D3+ H=ѽp@> Ϻ- 0P%C   FI(CFH F 0,Fim  IF(K!JH ! Fm[k  IF(K!JH ! Fm[k0" F!" 4H  0@B"!(FXmFOb)F F( H F  0@x+x+i+mm  IF$0 K@A J HB I! FS0I b 5m[km  IF0 KOq J H ! F+0I : m[km-O=P I C # D0.OsH0:(ږI H0'+ @.F##"F(2D !<(BF'-܅K.HKFKKKKKL(!0!!"F (쩈kԣ2*O |3 StJ$;2+Fo  O1 BnzqyOa FgIE#fKD pKDOIqDOc1DOCDOPDOSqDOB1DA&k&pMK)FJH|!0D"0 +_ >+ D '+?o =/ #SJL 33~@B9@B1JأgvA6B'رO &f13?,!!@C;2%2^A$1Bc22Hr 2M2zrG"EoB1FF#x*+Ԁ#+*+(\r''''in"on'o+o/o4olnt"9o2+Q+fx0+𸁖Jx*?)+;'+5 35333333333333333333333333!#%')+-/1{Kx[cx!9xIFwHcx 3D pJx*qJ&qIgx+FpH$nI7B> NWkH]60"(@FFgHfI\Kx+СxdHXKx+!y'FxOx^H^Icx]N;6vFEݸyyy(yDBWH7FTHCKx+СxPH.G0NJB@NI@H|:Kx+ IHrFGOFFFHh EIF.> _9(7_>I?NFF + CD ۲+p7(6H@i.wKx+?H2H!FAXF   :F+H$9FKEsE%H%J&KEF!H   9I2FJ"dojonn&sozooooooPooo"n?n(no*pPj&e5njkJBѣysjIjHjKx+?Ǯ"zygH+qaIaHaKx+?!z _H \N<,7XHO 2FRFX~OEѦOIHHxHKx+?a JHl sFFFHb'F 9'@I >FFODoc+t8)PF8JYF  F3H:3KF1KEsE/H/J0KEF)H  " :&I*J*J*Hbx!F2+#(H(J+F'H'H'H'H'H'H'H'H'H'H'H'H'HH&H&HPo"oo&p/poo?nj&e(n5nInRnnWn\ngnrn|nnnnnnnnnnnDn"n0IFjFJBF H, F%00I (F$X(Fi4pHpK"`pGpG O4S+2h @pGSBDSA"D RaEa@]pGFa&FH F<Jh+`" Raa ]pG Raa]pGK[h" ##!##3a0HO0]缽"MF! HX! FNC H!F Nj0H!F rp(eK%[hӱBF! #*F#!+Fa0!FXH@$  % U U F *FHFLHJH$"F DDDK"DIEH4VCHAIBH  >HB=H"!O0(" " 4Hp3N5`"O0Ch+!3h+" " 0hB+OsB H! FH4h,+OrB+ + O333,H缽"bZ~7%SKh#0@pG;>+r#`Y T! "D! 0"H!"aFI ` MF(` IH!Da([ k`0pĽ"g IFFHIHIH"F vpg qq h߻(0TK !oCC !B K`!03 CBKK ` (0TKH!0CC !B K`!03 CBKK ` (0A Fd#%BF#CL`BK`!0K ` (A#ȲC/F۲L`BK`!K ` (ACS_FL`BK`!K ` (ACCOFL`BK`!K ` (A!CCcoF#CL`BK`!K ` (pACS_FL`BK`!p(ьheI!CS C_FI` !B۲I`BKK `rr K"#I@h]m-AF!'FBO@F`)FF()FD(77 FhF]I*FkV(F` `0Fk( F xn+Kxo+4'k%FI00F`(F'x!Fn+ Cxo+0`}(=F `v(чVIFFH g -O]F S D`}rgzHgg $-Oi$ F #YHRFIF%VO&h{&_EuSIs3BRJSH3F FRIo-FPHh=F0KKKIMH-F\^(qhGHR5FNsh+l?H@I#-FBHBsh+`9I2 h@C8h H2F|LAH l kkKk kjjKj jsib ]>FHrs6xfxVxܿ"8F F I"F #x/+ !FH)FH8@8tttBx**I ATyF@h#F(FO3c`#h"!XhO0#hhe`i#"!(F#h(FiiF(:F1F(FLChsFOzrF FhF!ZCN(`h#2F)FpO0pGsFF F#!F`(F##2F(F hJhB`h(ѠhFhF^`ZI*FhHO3Fp8"qyP(< `0 <pGFFI°B1#>FOR@##" #>#? F!(h_2 IF HNH#`O0B B@}o 砆\-GF FFFEIP#m`D3OqB BORD %J%Ih0`J<DOsPFD4HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOr F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"R!KE" 0FlF@FhF8FdF/D#$B\5SEС.D"0BP%DDEDSC"B4 2F% R3y)`+JJp>s!tYh#I(F>t!hXkKbO HF =GD0ppJFI 2@eDBL @r[ CSfd04 @+F#"}hkAoB@jBoB@gDoB@dHoB@aCB@^3B@[3B$$#O @O ;FgKhC @`O*Fhk0#F0FFf`" XF4@FX2FM.@ !2F4Or! Fxp Ozp>x!h\eCC5HB@0OA###O30`((?h2@eDlB @r[ CSh0zph t([n@+FOxRFCFh rC2  خO F;"T"4"T"+[JJOzr>thSC  (FXIcd#ddd#c/!hXkPF?h2@eLDeBr[ CSR 2Ln   L Jk@L+FD0F$ $ $ $ $ $ OqD0 !@0 !H0!L0O30!OA0qC?#h2@eDlB @r[ CSR 2h Xn  @C. A +F-OF-!FND-  Gco Kh+[ Kh/W K4h$h\C#0 """8"L"O;A"E@B%D@8F)FXEFA"O18F?F@)F F1A"8FAF@,OQOp]MF`(OR!O1Op]a(O2!0+@O3,5KhKh4)H@ h)H6 LJh!hhcZcK BЉH& hYkK BЅH h2hYkBڀH hk_|HOR hk?vHO2 h BqH oKhh#h9kBZSB@V\3 ؿFfK F\CEFXhm++#$5kAkT8ESBdLKBD'a =Aq%@8$05<4P@B4OqsH 4KhK 08$<Fx 8@jw(+@DAF8&<FU"FOsXF9F%&8aBA"FXF9Fa#O3sӺHAF&F0$-BOCȿOؿ#1L 3JALq*O 3BCBsBL @`p  XJ#JCXC3G/3GOCGsG0 PlAG#V(F"OpJ3@,@pIDLs#09 F/Keh+!F,Hz3d3d4  $I #KO2%k\5#O#t+ gZKh#3T  @#*C@C9FCXFO""DFF#F?"#OND""݉6T$"h!%ZkRNhaH4PkR3bisb@bb@5lc@_OSfKhcKheKheKh0cXTcOs0HUP00hckP @X0DhbijR8d""0"4"^FT"ъ "TF8"a"""O`v^Kh+U\I # hY)hOPZObhObxiPKhyihh0+xiOr!WpB0+I#DKDI"FfCj(sѽJ0+P# 0*z+x; {.hO`1F F)1FOPObt "FF(Ob)hOP"H0+hMj0:4D\Bi"iBCDFhInDr  @#"C@!CF2 J~P#D"@""@g ht@yT+hj(LO ^FhjB@YH 8T<OsOF  "CBA\%IB& #0P D.4<`DMK B D p0C_C  CBvۇH( h!i 2Kh `0 0$%*Ŀ:n@yJȿp0h*@" t o[Bx0x #\0 2`0 H$%*cJh;3#h0$%2l09nCHd0 BTHr% )i ;j D;b.  O FDKE@ӀzhAK`BRFvq9nh$%* ݠi "@nG\:CBTi4K i2ah*Od zh*KB)KTzmR 1B yhP%BPCm @{*@i d0 (F$00 FPC @Z2R8  D~T"g TU D"000+ j;B,00#T003X0 BKzhB5smxBpijYh:bJB5smxBpi;j;;bhkZ*@ЛO Yk1Yck)FyH+DBӀZB"D ȡ`0%8 {i*DB@〝B [!Zk2ZcgJ{iBPh$5+nO n9D#2F8oESK$%BFQ# 2A# 7$ $ROjE;h#jjkF h!jjPn1Rk!b!$hj!Zk`b`h`iik _OU(D;h+aihi)Dhkci6M 0o+F(#h\%@*MBii&jCAFhdAq   C #)C K\%BM+h+^6\ zhOBvr:n 1Gpizj2zbU "TT"{hJF`SEvq9nh$5+ ݡi #@n\CTi i3aKh+Ld,{hSET{mS 2C {hP%SEPCm @*,d0LFH00> FPC@Z2R80  D {hBvs;n5@ Ui{j3{b  +KFOL O +$BFQ#0A#B D @I 8: z @J k08Px`0@OEFEeiE=D(F5 @E #kcDBhVHP5U\Bii&ACE Fkk  D idEu E   ,C)CDF [+6Kh+@/D?. ;h.I.K  FF'I2"\Bii&HCBFhqFBrxn  @B #:C@H2DXDBR+h+,hj;& Kh H zKh 4T"&1 O Z|:x* (F0UKhUI NTLghcgQKh+30304040JkhSC#oCIOb`ipAMfib!`+hh1F:Kh9K\5h0+WpOr!2KhCF:Fi+h+hiZkF;hPnHtL  Rk'@Ci1CJjcjB+h#hFZkh!jj1Pn!bRk!3!k`ijhiYkId D--%"#T";""8 "-O}FFFFJF:F(hI2F (  eI@F&ZF`2(F(F_I*F@F^0h+ZHIF~O0 }k6j`j`+k#akkcakakka@0#bB0cbklbP/}GI:F@F*0vBI*F@F"0;AIJF :@IQF8"F F"F;I0F9I0FV 7I0FP5I0FJ3I0FDh"F1I0FB,?%JkihSCB@6B4 4IF FD68FbAF MCAFkFObmFeIhб hOhU#  E@B 11h' FE#pk+FOb9Fm M"""""-GFoLFFPFZF kJ kI ;CEѢj# !06O҉J "# #^I\JXhRF+F@!kx  "#VI#QJ Ckp06&Xh+F@aF 06KDډ:ځ#i;#ajO 6SCBw>JBIg>SFG700F9FFF$&F 0(0A  6    J J &+FHFQF$&0F9Fb!KlV㱴X AF0F0pC O6&+FQFpfHF(FGZ׼"((`:F3BEC FCh`"Ei-AF8N0 0FB FZF"F+F@!*3j*FBF[ (FZ x2(*] #!3+BD +\C J I" C+T06&h+F@qF (FZR0&;{A0&3hpi;` D"ԍ-Oð F! F,K&00D4H6fiHF 6@Kh9F+FBF0DHD~C.$Ǒ#"4""-O}FFFFJFTF(hI2F (  eI@F&ZF`L(F(F_I*F@Fx0h+ZHIFO0 }k6j`j`+k#akkcakakka@0#bB0cbklbj/}GI:F@FD0vBI*F@F<0;AIJF T@I QF8"F F"F;I0F 9I0Fp 7I0Fj5I0Fd3I0F^h"F1I0FB,?V/I00FP"!8F1FHF0' 0BeZBOЪ# (5D*#*#0d "F ]( ##d@edA#zd@v$#$[$$+$?$R$g$-CDM$OcFF!FFdCFO4 F DM"FF;FHFF(F,0 12-AFF"`8F,F Fh3,x[x+&ICF:F bS-"F-G= -S%;;;ˊ;;ˊ;;g= +dDTv0F!FDT$D46DICF:FBM% I LF H I Hch5"x4IH- f g -AFFFF.O)F F`BqۆBxI+F"F B-O}FFFFJFrF(hI2F (  eI@F&ZF`j(F(F_I*F@F0h+ZHIFO0 }k6j`j`+k#akkcakakka@0#bB0cbklb/}GI:F@Fb0vBI*F@FZ0;AIJF r@I>QF8"F F"F;I0F(9I0F 7I0F5I0F3I0F|h"F1I0FB,?t/I00Fn"!8F1FHF0' 0BexBOЪ# (5D*#*#0c "F ]( ##d@edA#zd@v$#$[$$+$?$R$g$-CDM$OcFF!FFdCFO4 F DM"FF;FHFF(F,0 120" L xk%h3150 +۲T2 *0 ##o K"`pG#1FH`O0?FH "-OF-h"!F}R#h<chh#icii0#j$0j*#k3ck 80c%@0)B0$D0#F0"G0l2L01#m(T0-@#+ +gHKF(bHC9 ^H2COr@c++F3UH$ZcnPI"(NH"#^츨!nF FHIF3l ?Hh+npC_ICE7H7I"^pE_,B)7xrWBWA 8ysP")IjPF8J'QF(QF0F!Pߖe#+ФHYFiO O ҟHOr!F # ӱ ;BЖHFI BҔH"FF ِHF !FFC;BЊHF,D1*F;+لH"F %*F ]"+|HF "3*F$ *F# *F+F/!lJOaz(?!F3 'l1FF(npCOvF"F8F1FC ѧBvCBuPH +# s aBpe .FCsFKD )Fg h+OsDD<@p DWEb +@b0!F )F=5D%Op DUEF Os*J BBU HBO3 # p!F@sXCP!F0OsXC + B HF)F䋖Dh8AgØ B B ]OsJBџH B F BљHBF5O !FO@&O (8 B8(F a HD&Aѻ3!FODOPO`DOOvFk!&D'F#ػ :vH0F!)F0' 0+nKOrF! FEqһ ?dHq  +Os OI @p@s& #*0FF8"EsPHG O f".C/ !. zCE/8 OD7?KOu+F!!B(FK00i'+ Cf#.,:F/# IFM'9FB(FB%H@s# #Os@rFB,3##E?ͪ Os@rFHZF##!B H91D3j K H)FI* FH++## #SD?+4#O _л b +c!H HJF!F HFЁHQFH~HF{H zHF۹OvvHuHuM uHB(FsHpHB(F & } !##!#!`풋F FXFxF (F  +F3JIP  ##%&KFD @#$#!?J) F$"3#:K)FB5Khd XC1I20H,J#`+^л XOsBS BPBMӳ # C CE@)F "FrA?B;BFH&͙19AJRhqZE#g "F!(Fs @OsBB@# +s r +t ktO#tO#+uku+ka +b kb#bb +k)#p`3ih3lJ1h@ ,B"1DC#qilq DCC $!p:q zqq5\J[FOa"x3B˹#+p# kp#p x1+BKIT"JU#1"F)F\C?䨠Bs!AH'0 ! " B BBF DB 6K+`SS 31O3z3B%B")+p%+O""   ) !!T3Bѥ!B+F(F(#r2[C#2hCRsiP3i3[CB#hC+3iO O gfff֚ܚRRaA4-SЂhh *d A 8  eA K hM N OB`bxT1 #-@=B'0#pG@pGIFH XLg -CF FFFC FCOs(;AFF萱}Kh"!@Fh:F!F(FCA FHKhI"FF |h+ IJF tihhs`h:F#~' sFMh hJ@FH Hp"!(h hJ3F@#5#$0`KFH]I4,𵉰FFh3SBF*Fh(ڔII B#<02M@0hPX1FH ghO >/4'78F# xNKF2FlBF  OEcrHqHqK" pOaX`2+F@"D3`2!;rhCWI`K .ձ@ +qh{:+Aqq`h hRBFOrEHq;F2F2 @>K {(W #9Mc2ADIQE23)DB2,H ԧ+@ ph#M'! {:";F@ QEW;p`)DsF`F'+|##=^{#X#Mbg X#0#(#6e#ɚ;#H H; rhP [B( ;D Hr`B03;KBr` D;$8#ɚ;6e-GFFFF ` o jFh3ScEF*Fh(` 0+7ѝPkB/5,D h4TBFF h` 2B  0  -9FFH&0F #-CF#M -FF(F@ h+HCF:F1FdH`HIF\h?  ?H !!h S0+Jh< ICۿ@@#g  K Lh K)FI#FFH| 4$&"g IFF Hf I"F H` I"FH\ I"FHVIH"FR &g ~Ԝ*pF FF+ * *x *##pp\* Cx+IH@(F;'*"*+;.F;B+I5FH g  FKhhSIC h\B Kh ( !$(O OCOC`O0 $T$ $FFFP;F0O`#S`SO? F`,HF+Jh`)Kh[#h(I; h\B#(FÈ*# ##ty*%!%!-#h)9h21 RX^# #=#ctIH| ###%#0h!(/#@#o $ $T$g hhFMNO F+hh *3h[S9hO  A L#"`c`ycy 2" F $ $T$$ K : *B ( QppGI@g g F6IFF(4I" F|2I(F(FF FDB ,I-H #x/+ $I%I!F(F,*F+FxQ<,Fp/+#xk/)F F1x/(`FF+/* 2* cx.+1F F^&F4F** I$(jB=/+H&g f-O]H#1#3@#SaKbKSbKbK 3ObhH6H##*RѡJ#3J`J#3[h+(HrNFtFO*FIHJH:hOa FZ;hs3 + F8D"F9 + + M#SpFp1F0#xs1 @ObQ%""sMFt!Fx+F3/+ AOb F% @"@!%0 CgIeH2`4+aIbH PaJOa10 P A0ObVIZH%#8x+`+'?+&D+كRI KIPHIIPH!% @)ObQ#b$;$+%#2a;+R#cɲQccccccccӷcucc5' &IF ( @PF F?خ CK"`KhCK"F+F @a @ 5ͬ$$X$<$6g <jEY+8$|u IF z(@ @P?+(їI BHs A1m lIF T( @ÈԉI BK# NIF 6F( F}Kh|K"`3 0xIF (ݮtKuJuIuKjHuK uK uK uK uK uKuKuKuKuKuKuKuKuKuKn rIF F( @/F(?SKhchhI; h\B׭cKh+h+?Э H@FWF(w)F@Fa1G@FB O #! SF*FF#BRD DCIAIF+*2BDSQ++FQ NF 9F8#FCCKE@+?ml`<(h Ob`pg K2;"(HY$! HCF@ @U F #`C`MK-OFhðF.IND4mFBC4Or!(F3h"!Fq0 0(F&40+Y[Q0C+h30 yq#q hEy3#3E,0IH 髈0IHy3#3BQIH0 I FDB؁+h(FND $%g +?Y $`%K-OFhݰIHNOaL#H#J#hj0R+#OaH#J#hZHEJIIPMHzJI |IwH#OazH#yJ#h40R+#OaqH#rJ#h$nHAkJgI0gJcIfHfgIfLfK"ġeO#ch P +vpCOq!U8F[H/Ozr#@FIF"W"0G"`3`2Sk "lk bl bh`!i "ibi"&(4H;J;I `;,HsH4+?#@!@I2F2Hi#Ob5/F5F.I5Hm4I,H#2I(HP!*FRch!(Fw(ahS%IFHj#I#*Fh ??G 3 9FHgIOb8D8%g  $X$g /`$F$$ ]v` %$ $sJ#-OFh,M*@iNl"BkKBBИB ,MeMhCeKhdIeH #` F~(]Kh+ hr ``hn``hj`hf` ib a`i^`aiZaiVa O n2f .  kC c`k?`ck;ck7cl3dl/d  xx||!hMK+($T% $g ж """a" """CÄ ehih iÌ sn(? Nk#BNFxB宦KhJJh"IHK"`ePFaFHF]FY@FUFNMXFFFB>8F=F90F5F(F1F-Ob! Fj#Or #`OsOs`Oscaa00 sdcS0jKa#ca0C@S #dKa=;$ & _Jh*7 Fx3\#=#caiNl#B#i2|3 2ch2h2#k2k2#dcccfDH("hBN*BIBJCH+ FBI#R?I( hR,I"FF)FJF F9F FN2C F FKh+IKFH*FxOF`$g $ag $$% 4|GG]r%$zbPFGqJqIFF#2F!FSFO0hkKh#jI"FjH,jKh+ݮhKh FOq F(zhR`I"FF)FJF F9F F2C Fp FlRKhñRIKF*FxPFDJEIFF@#2F!FSFO0AF FDKh#4BH[hGJF)F9FPF;J/IF:H#ZF!FSF0Kh)Kh+^2C\X#Khk'IKF*F Fx"?4 \ HYFhG FF4PFhIF HjAF:!] $ٹg $$$$%=%"'IK!𵅰jh+EJFBKiCKBCHBBH4+=@J`#S`%K"$ %H@(9mH5c9mH3h+0DhRK`DD)BK Hm`$`$T%H$|6Hc𵩰N3hIHLMch"PF ((`hRJIFHx ."hb+`K"O`I:h hS5#h CCF BchF(FhRpIFkHFPF^O.3LF(hH COccI]HbK*3h:`)^IQH]H\O58FZJ;59;99;9h3`HIQHPH#h۱KKNJhNk#)FKI9Or#9#Q :D3s93hAKxt+h>K=K(hRI3F*FHF Kh  I+F J, F H Iz$Ǽg % $¼g > FF(I(H^ F&IF$HV`i#IF HNi0 IFHD j0IFH q FFhFx mpFCy+I2 FKhF@^(C@hR*F Ip@F Hp Kh3*FIp@Hfp<$Pg $ag -A/!FP0D'O/?/+0F'piF`0F#h0F+F FC뀄FCy+I#jI F F# CKhF( rhR"F I@F H Kh3"F I@Ho$Pg $g FCy+I~ F# CCKhF( 2hRF"F I@F H Kh3"FI@H$Pg $;g FCy+I> F# CKhF( hR"F I@F H| Kh3"FI@Hrݾ$g $g -CFx2LF.+ FFCx/+!h-Hp 2F )I;F hJ-A!h%H^9!h#HX#J h"I6Jk hI0J/I h(JI h"JI hJiI h!h F#h[I 2JJ$1V^elu~8&I -ANODFF8h "F(I 0 +;#0B#H+pyH!Fup%߿pmFFhF!0lFE*Oa&H)FQF (`O0#xF+K"Z` mpA+hFhDB< +#<H!F+I \p%FF FF K!FFh F FBI \1F(F@p%𵅰NL`NI VMI hKIKHr`JI 82O aFI#ihF(Цh@!0F(`#p>Kqh?+C0`h*F9H#8K3FF `(FQ.*3K%hpOOpCco h5%AOq hH#"! h@" h!8 hC Z7 *_+-+H1F ^.FAOq(cp%w >yZ)Do x%g$Q0ðFFFJOqFK" FZ`*FC0pp%Lbh*IH#c`p%x𵉰 FJ!FhFH"iF F DB8hbqHI LO%{Np%p F JF FhF!hF NiFF0h"F)F0h!H`pp%FJP!"H])Fð JOqH"C]O0pGF FKh.F ZhBZ`C!+I:FI2F "h!h"^phpt O3hX` XBXA F%d8 FEx- -*F!FF H@h!FFH8@H񃾓!FFHg (7((QּHpGHpGHpG M FOa\IZ M]g I n; f+X1 mZe "ppG@g FF9;H@+9H8I8FO51F"! G%  `kex#x˱;C3D21 *'O$V (>,5x--R# `PFhFM BVFJ.!HPFhFM C ,J.#(F I$ HRkQF HJ4 ,чg 4%%xKFk%+%x)ВH@.xK)H!Hx;+ C+++}HF|J|H|Ihah@!i!ivH! * tKL*F`ih nI硈nHኡd++% hH"!B dH@bHbHbHbH"aHaH"_H "^H 0P1P2P3P4P5PR0h(1 203P4`5pf(3 @j8(؝=V < ;:9876p:HJj+#7H##>g2H8硈#H2)))H,+H(*H#!i)H(Ih0'H'Ij)&H#I j"hx%4B1+&:HNin}Gfnxj-O$bMFF!FF(l,`0F*F9F&$""##!"FD D dQBOI0F&pPFKIF!DQ(FI>DkCDH\+hBHv[`h84Cy ˆry**0D@f@COqJHZH%"KF"HKK ]R(F((HIHII J #h9"p H BB70  !FOrH H0!" hF(h.!F(I0(p!hI%%0 FEhALh$, -T5!(FN'ha,OcJOqHIHOrH0,B$OqJH,! Oq H JOqJHv% KQ!pF+EsID.&"x Zp+p D p*ݬB"HppF%%"KsFhF HOq"`騹H.!H뀱AOrH #xkIOrHHpK"!ex- - FJ+FOq H`h1Fp@ Fp@}`%%$Dx,,x J#FOqHH@@W,%R-AFFa)F0F,F F HA*F+!FHAuF"F!FHAm-O$FF FF"F"#!D&H dPKBLI0FرP;FFF!DP5(BI.DAH-tFFh9VѸДy BEOx[IԔy0B y9F !L;`x+5;C3D10 ) #hP#"! Ih JHFI n; f+X1 :#DB(FOPɺ#`mZe "p ,F6N^@g `# ]#!"]-OF!MO 4 FFFF,  `V x-) 0( ((DV\*5O O hF#"2K!F@Ѿ?IFH @pg HFAMMF.hs+`6(@a;K@A:J69IPv3K6IF P M.MT1I1J0J1@@Y#Bw+p)I 0H!*p!p"HF( I   F!F <,wI :I 6I 2HOr@a I"" rHJ"  F h I" F d H IF F \ F@ <9%%IFHj "g pFN4hxF324 RFKFK,) ;Bx1h21 RpIo pFбh+хk`& 0B Pm% UCcPep(F`5 7 FFS+ hh"h ۓB(F)hD)`"`0@pGF-GFFP" ! ,FLE ѝ0 +Z1F$Hv |" !J @F] J^p #x !J@F## #G,; Y2 o`jD.#/<P" !l""!o $F%F'b V" BeI#F*F0 JI I"F(FP4?8 HJI""g 6"d K IF K K K K K H2 #"4#=#G#Q#"g 78MI,hF FL"h"ch I(h (hh3`0@pGp#%r#8FLرPh+;+J"2C@hPT8@IFH2C 0hPEIF H%#h z8#%#%{#-AF("F"0FAFPH0 I FO/F(FAF0FUP*0 FAO)K1+K9FHZhIO[ B |5V# 6H9F##%pQ& 6p#-CFJNFF 1+@1!S /}BAK"!F(FC Ժ+"L%F!hF F)3h B"8FQcP@#9F"hI k3`#I"8FSh! CBAEPF(@#9F"hI54P%%($$-AF/MFFq/Uj2C 2CM'HA)!S .?;!F@F!K"A ߾2KFHZh1+. CF+F FY K]h!F*FF H)H|Hv0%#%pO&HV&pF F&#fOb0 p*I"F Mj C3F FG1+K!FHZh81+ OR #H$0%#%pQ&c&-GFF`kKh۱#jH# Jp (%_U(F NFH dO7(%7O QF JF("D@F O0 I FGO i "(" BJI2F Dj'FFCKj Ce#("9F@F (7k  P(O D    eE('FFO MEݹ 3.K .J! ,3FQ   2B22QB22QB22QB22QB21HAFL#H########8#%k&0%s&z&-CF`"*x FAF/#FH#ZP(FN FP w#O3%F%9FHFUO0 ` F#CN2B,I2F b0/#C#C  #"F1F!IhjC!F0FJ3F!u# #5BܻO1H1FB  H)F# H5k&0%#%s&p&0FF%#UOv0 0*I"F KjC+F F[1H!FN zH zgzg+z;g+;; ;S0+.0%#%&-OMgOFF;h!FO[E,j FF ]J ]I TZF4!O F4PFWIO FOS AC@1+*F hO0?Ѵ@ N M")FHFR?F)hE ?IJF Dh")x(Ѹ?7IJFOX T# C/ID# F#F1+Ѵj2OCCFOR)F0F,j2C Q#1OR0F(FQFn*F1FF @D0h(FNz P0:FX"1F"FF @D0h FNcs#%5V&&-OFMF FF@F0Lx@F& r, L?+4V(0 JKKFUEށ 6s#%4ñJK-FJ8chJ K-FJ,@3+/KB+1+쁡HQqzH*KI/#h"k@܁HF!lH#3p+I) @́IOrHfIOrH+K^l+ AFOrH+ NIHOrH@AFOr{H+{<|IxHOr6AFOrrH+{(sIoHOr"oAFOrhH+kkIeHOrЁoAFOr_H+kbI\HOr_AFOrUH+[ZIRHOr_AFOrLH+[QIIHOr\OAFOrBH+KII?HOr8OAFOr9H+K@I6HOr?AFOr/H+;8I,HOr쀻3J[F !*OrAF#H!H*OrIFJ*Hl)Hj(H (/@ $K$* JBh+@/< 6Q&sށ '&'0'd'%;'N'W'_'i'q'{'''''''#%VmH H 8X"OcOs0V(0 )F0FZF0oF(0`#N<0lO;0mF(0C3N8XJh34m;3 1IHmC3H/k#h4+dq/`F(aC- NFH- QrHakH"p+ ьIOrHIOr0F5chBjBPFNF(?}-RF|yhQq"Ts3FGjJ!DDDu M"l H )F0F"SFN0 0{2C@3+`Hp#l{O + K^"F)F0FFk$*ѹ 0NILp#C3F@G2C@3+9IDH *;ck O O 0oF%0kN F(FKF0FN0'hC*O CDEX@FN F@FNh +O# F%;ackCEK0 `0 C $IF0F$RRF ` gk#%#%''&' 6d'%D''&%'k`"AF 9B   hBЋh;C 3D( KhBъh*O:XF MF( ! 1N*)F0FN|0?#CI* F*)F0FNh0?ٮ# OcO ;`BF;F)F0FNQ0!h +8hMAF(?F;F)F0FN;0  E?PFN:FF#;hRFI F*')F0FwOHN0?CFMF0K JIhb\FO;F)F0FN0?jHCF:h!F F#%p (-OLF=!''a2FBI0F #O :I0F(݀7I0F #O 3I0F(π1H2F9F{0I@F.pYF`0F&0B &H2F9Fbx+\h+!I@F(X.?fLYF`0F0BF/H2F9F>#%0(p^)[("(a(((R,E(E()((y2(\C(x+ h+CoBABOA0I@F*(9.?3F0+*? a)" !!!!!!!!!!!!$!!!'EEEEeEeEuE%EUuH9F"p"rHBF9FO O O Fl+8wF"F`@F EaH2F9Fx+h+o@CABOAhXL TEeL " (@𺀹@IJIH9F_\"F`@FECH2F9FOx+Fh+*q %pi\LEe HL*" @F0 T0 0`BEe(H9F@FD0"F`@FEH2F9Fx+h+kMEe#LXL# *|"xH9F Lsp ˹ H9F!)?)))(k*)) *(*F*.?TEe4 &йѸ3.(JHL+ХH9FѸѸ؝H9FћH9F3ѹP@cp#I8F(GxJ#8F@908CEuE @ "(`AB *h @ #B(+`0#u@@Fo H#`#3`#3FN|0-8hNM9FFrH3p#.!9F* !8FOq1`AFpOr2JFfKcJ+h8 p09FPh#C^K9F^H"8#4qYI"8F(usz=+ OJ8 Bm %15DPH %P44O C 2F #Oy(FOs;`@K8 : < > <0)F0FX"QFZ x$sp41F`S,YoC,`#BF;`;FM0hN)FF'Hh#CXI#H;+J!J"zI"8F(iѳz=+J8 BaO D=!PFFHPFqO~O E***0(p*#%* ++4+P+&e+t 4+H#4K , ( Or 0Or #PF0 JFK04Ѹ1FH1FqOrxB=#<I"8FF(3z=+?|J8 B'17D+rH^ h#4%3FT%u#h!(F1 oH\.RF豇hO- MaIFfH!h*FdIcLp00G##u"@T"@%.(Fp \ F@B@ـ(րMH)F0"h`!(F & ' X 'ppR:FYF`(F F??8` `@h"* :hMN)FF1H4 Bx.H)FA0h(/((0:h h`;3" L !MI0:Ѹ ;hF h!C '##0!XFFh+#%n+3(p:(++&%++4h,",,ƭ#7I0F# #3I0F$ '#F.I0F#JF#FX#(I0F##:F#MF(!I!HFSF9FVM0Ѹ ' FqOMvh+"FHFI#0 # I*FHF3F#3F ES#% (IFFHI"FHI"FHI"FHI"F HI"F HI"FHI"FH IH"F n*g g+8FKhI0FpF CF H)F` 8"F)F $*FFHp(%ع:ZmFFOahFW I"F hF  mpmFFFOa&W8H!F~ mp&iF mF(ZH!F8hH!F2M2C&h k`+h  &2F N(zp(%mFFOahFW8 H!F4 mKh  hiF &(p(%-HO MFFjF0 ,iyI Ff xI Fbй+*hOa FWR rH!F InI(i#0J(' F EFgIh FdIh8 0FaIhF(l^Ki ^I$(,!0F~F#p $F ,#+p>TI PK 3x3PHp0FM珱MK@LJHFF4HF`HH!FZGK@FJHF$%;Kis;IF(C?IF-oYF0FFPFݱ7H[F"FB80FM4 F)F (]h&FpEC]B]AF*I*H#FFEF0FF$F$H"F0+HF4(H!FO FFIH#FEFO   p(%( &Sg x-O'OcjF9FXCF=FO WQI"F0F 0!sBѩFO hEO(FM5h0F  chB h9FMF(=I"F0F |F('F0Bҗ0+!a `2JOa1K*#9E  `8d bF'H57%I F gK!JOa8FK8Fh0<:FFH  8F(*:FFH `( bF H|dedAp(%x#FFHF0Ls+FFF H( Fp@MtI FJ(1F I p-O F-" F ܡH O`hCL2 I *F ڕIEEДH*FAF,,,OcMK (FOKM OCKM ++lK F, *+n +k7FDF #IOs"[rOI"CS!\0Ъ "rJ[CSJ!J02FH V<H` HGQ@FOyRFKF"RFKF1FF F *FFH|*+kOK*^kFV++5~OjO O 3F!0?YbJS!0?L,Oc b[CS0?9jHHJQ`OxJFCFJFCF1FFh ,JFc CFIAQF` 1F;FUH { +xOE*H^+FV+QFOO O RF3F!0?OK#bCS!0F~0?ٮ) ` c JPF[CS!j0?Ů FYFA (F,JjA1 )H! `   FYFOxA (F-:FA1 c hCF! IAQ`  $OK!:FCFAQ`:FCF1FPF J HY@& !NIFH rg -AF%LFF4c`! H T@CD=D-۸9F `"3`뀹3` HbOaV@J I=DH(%8FL!hQK*FIhRKO2`8(F4hahx{H( "!h Hh J` J` HX%P&- %%%8  KhSK"IhC H! X%X%ȓ,%-OF MF0+<p/61F,M-I3FBF(h  (h:(H[FOb ($K"$I(h`#F8F MFJ xh320n+?+!a+'p+q+K"I(h`"FI"F(h#0)h#H0 I#F(h"FX%N@g H+F@<O"Mh27p<B7h7 pE=ѐB٢\+ZbE.F"p$+P2F!C ~K   x x8#tH+p,FxK@:fм[\Mм$bRENU2*$(\(*XxB*32 _x0/!٘xB31 \$LLl,4L$LO Bp73oDGH,,(3B #A$*FK J Ih6K"p@HhX%P& %O$;hB KMh.hCK)`h"I"F "hB3,Yh Jx; H(.`<`Hy%\%XX%x%-80KO2`@HtP&0KO2`@HbP&0KO2`@HPP&(KO2`KJIhP&X%%(KO2`KJIh~P&X%%(KO2`KJIhdP&X%%3M((`1`K#+`Kh$`+h+0J1F(F Z(=+h+:3hXh F(53h,Cљhhxa+@$K%Oh%K*F,9#K#Jhh;#<$"3hYhBF'ћh#8F)F(FL M0/KO2`($J1F(F (F O#F#ud&ZeX&T&P&j`-OLM`!`H~KO2` LM(zJ!FF (wK wI$`!FuHb(lsKhoNrOЁ"FF(a fK"%đB0+p/@\Kh+>S%h~F(5[K:F `hXKQ%hBVKhVKFVH)FS%BSKhd #FFLD!hNKhkLK"h`hK#h3#`FK`5h*x#h :h#3`2h*h)F/F(3K)F9Jh0h0Kh0KF0H)FB)F-Khd #F1h)`(Kh+?[$K h`h3h33`K`LP"O a #FD   P%#h[HYlP&Kh=K>Hh"X0;KO2`$ F M($5J)F0F (#F"F!F  YF F-(%>h+(H9F$2&K +hZhRE-ћh#4RFKFH9FK K(+hXh??#BA$0FKI#j\&T&X&T%X%P&ux&J2COKK)x&J2COKKx&-Gm`!`H_KO2` m([J!FF Z(XK$WI`WK #hHSKh+SKSHhDQI @!OHh\CN\#x0#3`"F( 7K`3h+X%H%Oh@ KO2`](( JiFb(HYh(K"P&up%8_.KO2`p(+J;()K )I$`8!F&Hx"M$N"FFP $K`h#x +`+h+h!F(!FHy)h(K"`)3h+K"h`h+h3+` K`P&Kh;>K>HhC\;N%,,,-=5KO2`O 2HF]#JF3!F.K0F7,5p*HFx(K*F(FF FK?|#z)FF;Mh, FF(FH(KO2` FCK,0FINK(FT%X%P&Ƌ&-A@LKO2`(Y+GJ(C;R#!B#>IDxx|+ 7(8H($5Ih,4K5I` !F2H<.M$܀+h3;B0۹ %K"`BK#J|(ђhJ#3K,FHNR$ /0FD)hKhkK"h`hA+h3+`K`4P&jH;FJF)F.;I"8F(# `#6I"8F # `獱(hF0 `hh,``h(h`+#`x(H:FIF@F FO0 E(F*FQFFh+3`c (F`` h++Kh-ѣh;hH+8` K M\%8X%4X%&h;`+ڊiB ( hZ `ppG]-OT I"&F&^(@O3`"F`;F(FIh 0 x+Й0H)F@$6,7 F T .3x+;!0FF(wIIvI FI(UtI FIsHrH*F!FO ##p0+.x5x-x/!0FBF_ѻ_dIZFubKgлл@,Z#x+YZI FO-+x3SI(F#FO (F@!F@IKk`F:!HF$FXKO 'FFO FO (G%F4F#;(F5F4F,FFF-I+K hh1!Fk'K`~ObF ` b) `K!h`  K`Kh+4JIFH+F8#F `"`"&7?GO|@X%\%$X%HX%&e+:FHF[(к WPF0,V$-+x+𰀸Ob!FVIObH)FObB ( ObNI ` c5"JK XgGL%h"`Ob]DI `zQF c0R%`>Kh$H=(36II2F:i0'I F%NJ!KO8FL4-QHP3,z#x+vI FIF(oH2A2A2A2A&&*A2;xk-"kKhjH8F$0`0hdKh[!!!hx-`H0h/!H0!!WK`0hVNWJ  TJ6 hJ|h9F##-@ǀLKMJ$MI`&`h$IH"|h!F8@#6## H/.AFK(}Khs ;#;. <FFFF FI@F061 "F@J)1x+м𵅰#!2H툱0Kh++!F3(I 'I 'O'M'NB Kh+3!F:!R#(+hB #+`!R#[4hdI F8#x|+ FG%#3`+¿33\%$X%/%\%hX%-AFFGI "F F3h8F#3F(D`0X% X%X%ȓ1%h yKhSK"IhC8 H 13 1Ch0!` X%X%ȓ1% K"`KKhSK"IhC H! J131#@;`0X% X%X%ȓ1%7='<OF0+ѕ , <  # !1'@C`F%Kh%JhO2`[F'"H!!K*`F( 0;#097+ѬKJIh~0+?߭ѻ ?":`8%\%2`X%XX%\%X%]%$X%X%RKFRLh h/1F@:F!nBFP@! hf0H#h9FDO#0BKh+ؿ<#Aq!!   t#9s Ozs"!"rC Vh+Rh#+'H"P&H h*O3 #`4!K(6 h"AF 0h+,h#+H h *F!8F'`0Н90+ #"!#8F& h1FLX%dX%Mb\%1%-AFgO gI#;`eKhF&*𺀽*aMd``K`Nh1h"`*h`) Or.+3`YN|s|ˆ6sˆpMKNIh$!$!`KKh(!(!`IKh,!,!`FKh0!0!`DKh4!4!`AKh8!8!`?Kh  < ; +?E G@ @X%\%pGKHhRX%E81KO2` L" hF( HKO2 @`4 8P&]%RFIFF F)F"8FL hF F8)FE(4p L hH H I 0 `hOaKH*FHO%O% LP H I d0hOaKH*FHO%&T%F H! FFhαF,FEмB20!FF"*Կ8FO0-GFFH7I@FF0,cG,\0N0K1J 0M)F/IF(hH F! FG~ 8 z+ F F5WPFCF ISFBF<,ISFBFhn F "PF`h0FGBh I "0O%90?L8x!*$*(b*7FxF2 ) ))X(*2F!x"-92 -?%[(88+=+? "((xK!*F0"8("("8(\-]x33x-"-![3[!3[F#8#8O%d8LK (8 K8#8`$8jFF $838O%@%@s%ML(8{QoxF#FICICH#OBp(ڂ0)$8+ 8hhpCF 6H(8Kh;`+ hZ ` "p)H'HCz3,8#H)h "#0F08& 8$hh`G48+zsh;`+ڊiB hZ `"phKB?tI ZI Vp HO%@%@g T@pGFI 0 I"F (@h L#h3 `KhB#hXBXAhX%KJ-O-hhC˰C| \!@F~20a 8t#as:( vA0 8 P@GXF1FzA0 Q0 F F 33C@9KJ Oq8Fh2JX{IEFXFBIXFNJFI+ FqJ:DOaaXF)OaaXF4F3qJ$D @2NF-O#CS@3E bJDTE+~V-vx۵sWK)nVJ2F pEq caA (F1FA0 Oaa! p {Z(FOaaF(F@J8Fqqx3JSFzD #HO0hZ`xMc& p`nCh;C`+!pCР + (,(\( `nCh;C`+\B> hZ`xhZ`xIl`hw4&l0& FOF9FDA.!0FF!FD7Fp9F0F*F|]d F$$&-OFLFF#x{I FMhf`h+ЁH!F m@+.!#1&(+0jvK(F 8+p +VCT (lKhFF(&F;+N!SvG68YH} ++3hn_!QI(иPIбknD!F( HHGHhnO0}A(0+8H:knB(3H3H~G(0+&H+Kh[hnBhZ`x ( (hnCh;C`+.D K Hh ()KHh"OQCT xTIhnCh;C`+,AI+ KHhX%$&J&P%jZX%X%)q%o ]%hZ`x h 3@ B""p ( ɱJ$pri2`hnBh:B`*BѪhQ`x!J`"qhKBKHhthnCh;C`+"C p (0~ B 30@hY`x Z< O#p4IHFa%q%X%R&6KhF;sI FC]xI" FhK"`320[K"Z`I FCDK"`I FC; K"a I FC2(K"Zao xAT%~h;`+ڊiBò +{ hZ `ppG?K@Nh5hO33`=H(6ѕ;I0X% X%X%ȓ\%F&Mh y+h$N3hc!B0h6#3`N0h(!0hO33`#+` +hN3hc!C0h#3`#+` K `V$I"F F`$X%]%dX%h&-OFgJMfKFfLhheJhr4 (#4{4+F3ph(F4 M$*@RKOb(Fh(DI""\TmB02 pBT3/* K(JB3Bc`#F$X%P%@%&D%H% pGFFFF1F8FFP ,o#`J"` J"`O08FC\ *F"T,##`>BNsh;s`+ H| ( K#`o#`3hZ2`x +0@g -CF OFF8FrCsFBFH 5IBFaB #H9D;U$BKI J K(hhhhB+`  2`@%@g X%X%X%-Ol FFFk & #cQF@CHF|PI@B8~I2F(F4}Kh+6Й FqhBi.F2i Fi0%#! bh1@C1iiJ0iI `@B a`eHtO0 l "! FhBF]I+F]H`@! FX0XH*FR`#$0<`0+ ( !XF !Aq !RFIF F<0jXh$+9 iO 0+;!HF  t#9s Ozs""r!8FCC$h+ h#++hA+?u"H*FO2";FAOq F0; #2F! F0 I+FV E(<#`&e\%(j<ix\%Mb8F FA)F F8@ϿpFFch;c`+ FCFѣZh+ѣ#`h#+h3`(Fp#hZ"`xF FF!F8FCFѣZzh+ѣ#`ph#+jh3`(Fp FF I FFhI F#x 0FpH)F& 2FB| I"F I  F0I"F I ZI 4Z𵛰#FFF03 FKhB;#HB1#He(F(򊀉LN/lЉKh8FF(FD4 F|"F9FFI"F0F"F)F0FB7FyH9F(F@ҀuH F F| F!F FlHF(F!F(F,@dHF FW F!F F x+RZH#h*F0h+>WI#VHP"(5RKRI0hQKO2`%B#< Fl!F FB}#< F\!F FBm(F!F(Fz,0K`0Kh4/KO2/M` .KhB)F,H&5+IOB*HH)Khh(Kh &J#p&J`%4,h)H(\%j\%X%`X%t`ht|@g DP&@%X%$X%q%]%ě@%X%X%H%D%78Oh#+ hi!FA\(o+h0## 0O 0+3!b t#9sJ  ""r!>Ch+h#+hO2(o Kh0IF Fv<#`bMbX%\%ShFFF{O`A``0 #`#bOc`jj%B1bhp3" #FFXjj+%i&0F#ibhY!aTh%iB m`h5)FA(0 +h0FahBD5*Fv#sUh+D`FFFF1F8FFjK,o#bK#` K#`O08FxC\ *F"T,##`>B" +FF0 + K#`#ob.pG!@!H\ &K!Z0K<13HH1hGpG\ &ZKðh#Kh;Kh,@ C~I |I {HD! ! vHtJ1 tHtI !<hGnKoLh!hٹ FgMA,lFx@+7hN#hx#_K1hG+qbH(F(4 h#hx#hx,+#hx##hZ"`"p11h[hG(3#h3#`NMNI(h:F`EO"FOq0FH F)hEHEHpmF+hCIx+h8x + F>H_3+`+h0FZ*`"pt(mF+h6Ix{+h8x + F1H@3+`(hkFhx:hx,*hx *x"#QpMJ1h[hG Fzh2` F.K!FFh$ 3H&<&d&]\ &T&X&~&$BP&mK! `t& IK"`&!KH`:&d & Kn:f*oB (КmQeppGI@g g -CFM O"(hl1+`&O  "(h 0s FF H>I"(h&d &&&HX! d! ` CF3И8BH>! J! FF @!F <K/!LA FL`A" F I H I !FIHIg  K"sLXhIT1N[P+x;(F)FFphDI"ph@K "ht0n+Hp&b&ȓ&# HP"iF Khs K\A F(H!FHlF5&;F K!hD FfH!FHN &PU K|Al#x[ FK!FFh  & K7FLA/! FHAJ# F+F0!FF pFx# + + `F+FK , ,њB10 kx pSFB-CFMFF  *hjhFh!FH$F$X$ 6K"hx 4KC53H * -,K1 (?p F FF I<1 "K"IXh J! +џh* "" @BѐJf HcH&ޗ &&p&&g&&&z&&p°9HOr(F(@6K"6IXh! \! X1J! F/K0I"h%,H&F4+K<1C (Ha'K""IXh~%J! f! (! $Bp FFF(݅BK!hf )F )F H(F*&ޗ&&p&0&&&p°;HOrF(@8K"8IXh! ! 3J! F1K2I"hB|%.H&F-K<1C p*Haq)K"$IXh'J! ! ! Bp FPFFj(݅BL)F h! h $)F r)F nHx(F&ޗ&&p&0&&&0MF(hI FLI hBbCc `!(hjJ! d 0"b#c&p&0 MF(h I FHC3(h!@ 0#3&p7HOriF(a4LhFbcy#cq0K"0IXh.1 #10D#00#01 1 #11KHk1#!1K`1# 12 #2 23Ht@HH:&jp&|"LI h  hI"@U&{t zt F,!@ 8F F 8)Fg( pmHI ` h h mp(AH#h?JOatF`$$O4O5 3IS"PF@ -J`,K,I $*I (I &I ;h%J !%H^#H(O"I0KX&&` &/g ~'Rع¼9yt&l&&<& &ʫ"T&Z&(I"(K2``p0&I&H!5-"H#Hb c\B\A#J1#<1K Blh#13h8hMh:h IHK$[h[ ^I 3h#8h3( <& &jg &tع&H!@&6I Js(2H#`1Khk :-Kh+P 0jh p&Kx+ !!#K`"L b h(HK"`Kh+!F h+O3#`KxCC L! h( I h"l! O01&& && t -AF`M.h.s@^HXF]I T\HN[J x/)@=XI"F>;UODW)@RO;hCQI:F>0OS;`NJNI>MO0JJOc`;h+II:"=& >` *aCI"F AKP``@N3h+)2h?K`">K`>K`"6K`1Kh*-1KOb`5Khk`+h3+`lhT,! F#;-Kh`` F#x/+! F4`(к{7 dOR`"H!F HHX+h+q>7m.8Kh`KhI"F&&L@&$X<&PSl&X&D&&&ktI:"=sNsK8 `3hsqKh)ր8h0@ 0`jK:"jI`=hK" gI:"=cK"l!cI:"=^K"``I:"=ZK"`\I:"=UK"!XI:"=PK",!TI:"=KK"0/I0+J#`-J>&,I0)J#`*J>0'J #` 0&&X&D& JbdU &(&|4&8&0&$&,&[ &&&<IFFHIH"F g JhI $&t HCh;C`+dC hZ`xK[h+ ##@@g &L! ^%H`J )F&J! A&J! 9&0)MF (I#`2! .!H!F6 `hLDch;c`+ FB"p   KhXBXA0#hZ"`x (pB3 &#@g 9FJpGB pG pGKu^&\'+)"HpBIxF{YpF1 x,*F@2kZp FI*F^!?!+& ( K @0^"ed""f"HpG(? "de"&&8FHLM <8 <Kh2ùlFHt  <T< "*"FHb 4&"0 MFl !F|!F|#SC@rp"CCI 2C32""b"$ !b#sCcl!@ 0#c&pMkh FB >(h+ H>#x+Dq2;p@Hp&1KsnM0HKhƲF*xZ Bl "Bjxԝ$F Hh0FG Fp) 5&F+O,MA #xc?0FF#I F#k` I F#k`FPI Fz@I Fv0I Fp8I"FHH0#!FN$M+4,B+! F!#!&ع@FJg l!&K1#Khh J(&"KIXhZKI"h@۹&p&&ð#O ")F8h&Fz+x +M##p1㹴B!#1y#0K "Xh&CB*8h")F;VKh( I0Fd K`n#y#0#1&&(&J 0[ `pG-H!M XO! WI hTI ;h#`#0`##O2! F(GN"8h1F(3xS+W+B+Ob)F O@ &6Ih+  *Kh++F!!E&NZF)F r1+0+ж qZF!(Fx @+o(H  Eٛ ^+h;`+ hZ `piB (rF&'p&&&(&8F L hF F8)F(Рh )F(4 #KCBAD@  F F@y! H@ſ'y;+&!0h&)F0F頱P0F?(F`H#y#P#qcyCcqhB`+x !;#B`+x"{ ( -AFBL%hk!+@OO #h"+%`7h8FX3y;D%`+O4NGNNNX;n;;f+:oBۻmZe-I 0{(I5%` n; f+ oB ۋmZe!"p1h!H(X1! H9Fh#h3#`2F #h)FD#`h9FH5%`#h"+#H#`A H9Fh#h3#`(D,&@g g 6 pFF; B"BF*pp\+ ^+Bx@:Ӳ F;Cx0ֲ.Fx0:ֲ. ۲2x(ИBSxJx0:Բ,> F7I(9 ! FF6=! FF(8#p FF(Ny5[!(FF8Fn4F`y! F4#h+L#h+H>##`LI FT(FF)F?! Fpp F]F@y!oh(F#x!+ ` FK!F!FH,,&yJ pm$L%F h\1Oa!JhFL IhFFPN"F@1hF F:u0#u0 mp#y՝p`#y4BT<hD<3h HiF !hF#phF8a $&k pF FFy[ F\F(F pI0F FXF!F y7$MI"(h (I(hI"(hI(h"<H F0(*I(h("0!HX HO!( HK!( &f f@xt yt j 0&0!I$ @K,3CLtF0 0 0KjrK "h FhPPB +! ]4B/0&&H!H,0@\ 0&"%L&I hf |#I" h^! h{?@ n! h{I" hH}0(3(HH TI h6I h" H h!{dI" h$ h^&xt yt    f@ pFF(gHO0>(P ' TFFC O3>FF=FF o    ,𭁻@ 2*WpO O O O O O "F2 ? mH8O5F ( DOX GwTй#_H9O x*"+w#WH(>>"'(FQFOHNK"`O5F"3FF < mBO #e x*О*AH32&Y FO0>FkHkJP %hQhC 3F   "OsaI8#`K% o h   llF@WH,FFO5FFFmF%FFF# O21F?JHO4MFPF>C0F>@H(FIF4`H ùO2 QF8H)8FQF m~ UIy F !k"(.H1 !k(1F  7C #ЂBH+FO2 lHJ+O10FC#;C# "1F(H4Hz-0D01Ve)12 2-CFHFF 0DHl#&o` FO3??e" F ??4H$&F8C0H;F.HBFFXH;CLG@@p@BgGG/9!KBv+&C4Oc!FXCzs!J jkD I, ,."H,H)FC4F@d@pDtv K#12d2~222g ۄ0 V(HpCOK ""[h;K#F9-0$"F)F BC$D, H+ HJ! 2\&222-OFx]-+Cx{Kh ]Ov! ],FO9F F0#!>h+ Fh FXD0>jFH!F2F0 (DFH)Fi@F ]O>YhpCOрH!FtO@Y)F F !FuH?l(F*1F8(FnH!F-hvOb!FpCȱOF8Fp*8F 0B>1F耹0F{"(F`(0!F TH 0 CQH!FOH#"(F# 00Or@!8FD(FF fp;H9F&0KRF#(FO6F1F(F4F(FFF1H.0F>-H?? 8F'H!F<*(!8FAF!H9FP1FH9FO#EE #ZFHSF(F8Fz Fv) FBF"H!F\&2223.33P0<3Q3g3}333 0[#Mv#JOa8Fh#FTohhp208D 0Or@!8FCFH9FH4%P)F0FY0F 0+(F0H FH!FQ&4@g Q34FF+ * *pGF \,\&FRa/٤A/  A, 3B0O0KOh`Z`]  KhK Kh3 K"`s    Fp&S&$& H! 9 >5=8FR!D)FF{h F8Jh3`pG&8Fh#x-+4`o8F " F (+hBO0O0KpFh+NuhŹ ! F Fh` F!0I"F`shu`+`hh!Fhp-hFJ@!hF6hF&'U5F@ͼKh# F@O0&8F F@Kh+)F F8@8&FFF1F(` +`#` 1F8F `(H1F `K] 6Fs(x08 Kh+ F@t&pF-J+x+G$I(F(!0J1F(F^lpe5]0FM FkhB F!d!l` 0KhB!pG&K!i Xii&-A F xFx9 KF!a F M' J)j/`^&J F)j/`^+hCE4F&i?-AFgNsjB$b(("#b #Z!wb kc<#czot=؆(h)K(b!(X2(YН0b03c0sc#s#xC#$0#0 0"0n(5K"8@ؖ(:(/K"-,K"'O;ذ_4ذo-аo$K "_!K "aO'а?'аOK"KK"K"K"K"K"K "K " K " K" K"K"<ĕI&u'Db&7 (IjFv'LH%'H$(1Ц b0P+#b HH"(#jK b`#j+ܿ##bűfH0v(nfn+ܿP#f0H( H^f H(ht@&p5k5v5h5{5(&Ll(D8(A #&)@@@@@@@6((O0HHHHHHHHH(#ml0HH(# # &5555555554&5-AH\OyL@ 8`HQ#`K(FF_(H#`w#` HmHhHcH^ aHZHUH(#FF8K"`KH)FxKp)FHN)F(F3FH<)F(F3FH<)F HK)F(F~H<}K(F<{Kh+uyKh+@p)FwH)F uH< l(^pH)Fax#ckH)F#i`a+x#faafH)F x##aaKFHe8(F9F#0F:F&F3x$mK"`ll#H)FD (? x+?NO 6566/&6Kj l&Kj d&L(=KhKhKh Kh#!j J Kh#!j B#(=&lT&&S&(T&,T&Kh(K( 8 pG&&K! &Kj$ &K! &K! &8 -KLhKh#Kh!j <xC<x#8 #,=Kh#!j Kh cK%(]h;8@ 5 #jB8lT&&&,T&(T&S&T&pGFK! _@!&Kh;K xjpGT&&Kh+ øT&Kj &K!i{&FFF(1x(.+(4#x F-;۲L+JO7V(cx-;۲L+CFZx.+CF#X7`,`#JyVb o dFXI8HO1@uiF F(())HK[M^)) H K[M 1)HL)H/66d%606B8FFFx ++!(F<#x++4 F8@8 LH! + !& !! !#`&/BKhCCH@ `pGX8"MFF  "!F "!F KhKpo FJ`8 "!F&S& KhCN Kh4@ӹM F@T&&FKhX@0w F@&FF#XBXAKhH K! ;6&-CFFFF@ @B 0??FH-!H!C WH)F (FBH!H)FE8]ToIGCH!DBLE4B<I-C "O2@6T6k666V!TKhB233BpG$&8CMF+h3H! ,`86-G!N3h+ OAq:hB 2Rh>Eli $ #S``<0hB#+bNki  (i08h,@O3a<K!F<`h@d$&&Kh@@ipG$&0F hDHh8#hBC!B 0ZrR@hBQT20BS -CF-M$w?+)KBKb+B..+A0; + "##OO  H!  iBH!  `K;+#c+$3x0;2 o($$K%&&&7-7pFFxM)h! FhlhM)hY6H1F   5 F@hvkh "` p 5\E7FFFFرK1A?+x2*+!kxcxSn!(,F ;^+#x*+ cx[s+d+УkKBKA4;`4`n!(F,FuSBSA##%& I<&H}FH H H H ,@KH!4!!8!!F[(| FjH$2iKjJjI`iH)iKeJiIWU+cx++44" F Fx-* BxU*+0" F)UH  -#x:+QH!  #cxc+).+b+۱4#x,+4#x+mx+*00p+w+1H" n1H"4,H" c*H"3 ! 67&&&& &&,&&%&Z7777XX&&78\&&f77777o 7777K\pG%&K1F0J FH !:)I Hy HB@FFJH F !pP,%&eH`&&88++++(   pG pG pG pG pG pGFx+ FB((, O3@۲B SD)ѓB Sx@,hZ`B [x*+pGpGFxF8(+>FKxb?BKxx?|cCCKxx|3Cx?C|`Kx@rx|C y?Cx|2CKxBy|SCJy?Cx|Cx|2C4Kʲ1h ):po?B c?;phY`p??4C dphN` pq?a9phfO`p%&KpFhh)ݔB ,`pB <)#FBF;)FF x&B F4FF %&F I I Fx I FPKh+ FI@ P&&H&&\xT&dF I I Fx I FPKh+ FI@һ P&&@&&lxT&dJ Կò\pG%&(7FIHx&H0(@F0ӲHJ !8H#FT!p ! FF H#FX!KOq$8!Fp8&&8%&FIm( FI@f8&&t@DcB ѡ"c+ !@%cXBXApG pG pG*-A FF FFF<`@0FwF(Fȹ(F;F0FO1 J)F((F( $$$&&FHFHI*FFI"0FFxHyI*FF*F0F I@I*FF8F;P, F<<<<<<8FHOFlpI F 혱 I Fp F8@(F8@ (8<d<-O F F  FF8)F(!pCO0I FvF F;(2FOa(FX8)I"(FF(F0F F+* * *# pI(F@I(F0I(F +x"+/t#h+ ;#`2FOa(F (+F 9FHFGm+*F! OTF O\FFF9<<==T h (HͿ.&sFhF(F`!* F"h#R3FF(FppF F&h "ap#i#I(F&a$h= FFO1JFh+FF h:&&L (8B8#D8 HiF+2 8 8T&&.&pFF F)5hB AhhK`hB%`JIVM+iCIJ`hLah(hkjI`hJBahhip@~3B J`h2FIp@(*pT <==K"8p ((((O2KbpG&&T K"( ((O2KbpG&&T -CF|O N'#x:F!FB0# (FD ((D( (F#)FHF((F(#&&&&7% L F@Dx(F0"F!5&&FLX N8xJ8x8B&hF 82h;DB8  8;D 8hF+8 &&0&𵇰)L#38B=B+8 (+DBO&8#D;h[scڢBh(0F8 8[ 8+2 "]D&&0&%LN8#Dx3h[sczx8HI F>pD+&&0&sL8xhFK (h2DBF(F8 83D 8 18xSp;B8[x+hF+ 8&&0&pLXB"8^]k. KO2b 8B x@ p 0F&&T K8x#@&&8 L#x%X8O2pKb 8 &&T pFM F(F@sB p(+BB KO2bh@ xU;;;&&T 7F% x0!*F F ( K$ `pG&&-CF xFF+7KhlhB)! F0Fkh%`c``l`h 1F@F+; +p; +R#vuuuuuuuvvw +R#kvuuuvvuuuukv7+E+Z/+ѫiF#+b)ip@Thq`p@ #x%F4++ ++L h:+x #`(FQ `Ax"+ixp@x"+i@xKh+p@ fx!+hj: FhbKh+ohjIHp@кKh+b  I Kh.YF(1FHp@4.&&|&Y= 6_=e=pFKFFX`Z0F)F Fp@й.&NKMi@4@F/#s`=(Fj(F H, , K!F`@HH.&dk=/& 0*LhG7#c`Ph%H\hY#HVh!HPh[HJhHDhH>%hAJ+F!.5-ѣh H%K"`0L##L H H.&o=z=======/&qns-!Kh@ KXhi8 pG.&COppGKiFH=]! =!F KhD```.&K𵑰hd#xS%oF;.FG%B W&>#x5 $&!F J#`hD` `Fh.&DF F-G#-Le&O`Kh3s[;`O ch 0 C KhO0< #hOHoh ( RP[ԁKh 0kgPHwKh0 k+J rkH>80+e.-F0+e.@ch+s/+F+N++D (@-y-@k+7666666666g666 F EH;К0KO`: PFM7+i+$ -@>,0 +@9.-6!(F d(e(F+Hch #c`ch+(F(À((#Fi.@chi+$0FI#"(F#jcHi3@_-##b>.&&&t&&==$/&4b&lT&/&+-@-&!- j+| - Y -W=-U(FH(|--)##CaGp)#@az(@V(?_xa;+##a b x(?Ei#a+ 8O3+?4'0 (?(rH e&>#bwi#@+$УikJV(F(#j+(F b0(F_Ha+##a j( j#FF/ OShX@x`_*-9@-E!-o -?(F(ch+f+ƮDKh+?F(?>N+x+Z :Kh 3Kh+#7*#C`Os,Kh+ch7+Occh7+##%J#!01+ 8#@ch7+OCOs~#;+?^#(YF1H")F @ (ИhFP0f= 6>S&| &>>c+R#߁ۂyŇG͇=WsC! ه׃M[-qC kIki{E ه }I#" e&2+rJ`#*s\Kh "! i2+rJ`#*s:m"! i#*s#"#[Kh+ #*s "#*s"##?";K"Fh4~K"Fh#*s#"##uKh+*#*s$ q#*s"##"!#*s_Kh+"!j\Kh F F 2+r;`PKh+ -"8hFG2+r;`"8hFUv xh?#=N*s#"##3` '2*  #ck ie+rd;Ck+d"##w(q =l(q^) F Khb?٬HtH@dM>h> &>>= 6>>>>0F(7 ???.Kh+((s "##(?H!?Kh0Fo  0F0Fj#&abF(?1F#aR#wIF uKhKuJuIvHh.F0F sH!ʺƪoIF F( -e& % -??.O1(F!tc#`IF> F( - -?(FL#UIF miFp( - -?}(FvBKh+HIF% PLFS(e - -.%(F"F(Y4J% 4I(Ph.%#7IFw1+q4J`3HhBOvv&F`.K"`1h+߿+Khs[12+r!J` I hD `h+߿Khs[2K"`K`Kh+?#c8T&>& |& =7>>?? ?(?T&0&/&0&hT&Kh0pG&&FF #O2B@# 3-OFFFFhD,FW E[լB< +4##pd@F>2F!F(B'J;hB Y)(*B8FHFFBFIF(FQHF9.HF9 FIF\[K# &&-OF'ѽHtE0 *5"pF*xc*"pB#ҕ0+;+hx]DFh*ENF>/#F*+N%F{3?pF FFR ! 98+hD`4D(``` pO0-MFOO O $ò0 *;p&  `Sh \4O07F e 00;+ (ݝ0;+ A-@,A, Kh+ C B Kh+ B C 0m+KhB# &K"`S&&/&F' d 4F<`E$hxxBD-XXx](g(B 5`@(. @,A,,e !Kh+ C B Kh+ B C K!h;B# K"`D(ѽ@ _Xxg(F;+xF0-((H30d(f(i S&&/&L h`hhh@4/& FFH0ѽ@!H4/&5? FFH0ѽ@!H8/&U?UK-GFh/@9FJ(FqF(FfO78F!90F("#(F?? F92F!F(FF(F@OsCEE F9S #xCcxM+ѣx++xG+ <<+1F Fu+hB0F Fk8FGྼ&KhF @ F@U&F xpG%*Zx%*33s*0@0pGL h H `H/&"BB-G!Fd Od O FFsh;s`+ 0FN (F'#8F#p3hZ2`x - 2BOI !HF9FFuj8FGF8b@FF[CHhK(F0BG-AF,!DK"xxBFI4F#x##8F3p xBcxB44;>FFF#x+5*FAF F,D;; -OF8$F%FF,K,JF,K8F!(FrF=!K)F!JxsKx Fx5BxBDKJ(5D$O 9F (FIFu5D0;//pF F ?BFHF FF0I F@o8FjF(Ff!D4 F KJ!F;FF(F8nI0F.F0F8f FFB9τ-AFFF %(Fx+0F0F,!D4 F7F( K!F JCF`/!(F((F8*qnO&FH1!F"@<-AGF=F$?s!`FF?(F#p#+%+ѮB,B4jxB%+ Kh(D#+%+ѾB,B;zxB%+ Jh(F Ft FD&&-GİFz D$"#(F??Or(F1F(pl5>`8hB,Կ  0K)()F8F4*F!8F0+F F8*F9F0FPF((4&&DT&-A@7KhF+[5Kx*F<F(O1HTFq/K(F@FF FD6!(F$K)F#Jx#KxCFFB8F8gE0F0D߹I"F0FhF0F8_8FbF8F+x[(F7 F I:F F,F7|&dUBLB ^B xuBFKh#! FP3F!FJF(FeFp)FFF F4F78F7(F7 F$|&}BF I`I F8I F@  d4NAmF iF F0 F m@hF mHK-OFhFF3EKhO0 BHoFбFxFF3|*-* F(F(F 9H!7I F,($C F/F(FFXFQFD4 F*F[F!FFPXF7"PFFPF7-й *е@ "c Fr((F$(O3H;`F FP H<`(FNF(F#x+ F7T&|&>BdNA*K-AFh F.IO0%HF(?(!H1FAq(FF FF8FF(FF0FDD4!D F#!F+F:FF0F7(F7@FF@F7, FAr|&BBiF( p@CXBXA'] 0FL#hx(F<!0)FFtRI Ft iF(F^((FF F'0$hpCO(F!*0)FFt,I$@T&  Fr((#" F#pKFh FiFKbBBKbBBѴ??BA &p  &/&/&HpGF DB F,C/*FFO`4KhB 4Cн@ sS&_ KBBB Kh@_@K/&T&8Kh 8??o??F FBB   $&X 0A(q4 Kh"`$pG/&-ODO;h+-y$%F&F;hB 0+oj$%F&F8Kh;Bn a(F1F$F FF4X ;hB FFF?? 0:hcB0|Կ""00j1FD(F0#00000F FFu( S&&S&0&\ &0&-OFFF@Q&KhB@$Kh+BKh>&??@.BD0Kh;BBB G F)FO CoBB3 F)F0+B-&O qKhC@𵀿gF(ıFeԹ3ݹ q F)FƹcJ0hCbKhе??b_Jh*^^J^Ih h CX"` ZKh+l(WKh+VH F)F??F FѺ!F(!F(Kh+ !(" !OwLFMFr+K"`1KhX )K"O0`OK~[???&!Kh+D K FIh hC@sC) O1!)F F)F F F??O,&XT&T&&/&DS&T&S& BS&$&S&d0& KiS Kh( Kh+Kh8pG pGBppG/&\T&T&&-GFF FB(4KhB#3Kh.Կ&&??.Kh+-KhCBOqu1 FO3"F+Fm&X"KhCѹF  F)F??F FѸOE7O0Gze F)F. {Fy &S&S&d0&T&-OFFFp&  X FO߸o??F F>!KhùOܼK h9(#"F@F+FFLO F F (o??0$%FF F$&&4b&-AF FF??F F &AO0C*F#F8Fh8 MFF+hB(hBԿ  8??4&K(FFhB pG K(FFPhB pG F @F޿8F(Ma+hB F(`#IS``#hB Jhh;`7h7 F8@7Zi:Zah8& /&KhpG/&-GFF,O=hFBh F(G0FvFPFpEPF70F` F7~B-8! F0F`0F#EEF=F#wa#a 3+h 5`\`ki,`3ca#hB J F%Fh3`(F-hZi2Zah /&hpGhpG@ipG Ʉ 0 FȄ#wpGpGi DapGipGipGapGcpGkpG8F@k FB7ec8@kpG-OFFFgF$??#(F[FQFF0#!2F1@FIF;FF ,-O FF ?? O4%F F)F Kh+rѲK FIh hCEs) O1!)F F)FF F F)F(ѤN'FF3hB (Lj8FIF>FY8FIFFBx>TDF (e 8 K 0O4%F0 .q@cF.F F +HЀKGE{KhCў?i uKho2FCFF6H nJh к  6H ( (O hx &O (з6FeuE WKhCBO aKPF"+ !8FIF( FKhk^E FF8FIFAKh+??7L ( (0 Ovt .O  B0Fanұb$L#ḫq (0S#KO"`F FO J@aux . .,5F FI ( ( (A (%F FOFkS&d0&$&4b&0&T&0T& T&dT&lT&?? au7 Kh[ . . +F FF##hNT0T&7F FpKh*Կ""#(F!F#)0"0&-OFF.x O33hKh+њKh@BOqx( FO32FCF KhCph(ыKhF , ,фL0h#h ( (0y{L#h (RWCA(T O9EF# MF3?ybKh rgE (O;h;BT#`I"4'`2FOa(0F|h MwI",sI"8!h!hg mI"(z  F=3ع!/й<Щ ^+-#0]HQF>Zx=* јO+ Zx=*јO- QF "FFENINHZx=*јLJKF!PF< ع+й- kiB!! =kiЙBpmkiBԿ!!)ekiB̿!!ZQBQAkiY!eFFF; +7#+Ѣ +<\+# p0+?<   *r=!PFEF;,+*7  XF/0x(O!h8H@@/&! d9D DDDD(D 6ODC !HFU@UPQ H H H HP8hT#iiC"Pi3/&t0&0&0&0&0&-CF$ F0+3eFFF(F!F0ر#JOa *L(M  +hB! J??ЍBtJBA JOq$! 5 @Q5S&S&/&S&PT&T&KhKhKh+Kh3pGT&S&PT&S&8 LeiiBcia0#`8#iS%0+hHY]5/&t0&(F FF0@7Kh#FI(bO4 F1Kh (A(: F,N5i($$+2io@G;D)FR#58iD3iS'D(F(гi (F'хBJhABJhBJhD$Z(!F0F2iC;)FR#(СKho&&/&| & &p & &-OLgF FF0??t1+@O`D#C?? з??вBADg#1-𜀣ih+@O1FiPF+ÿC!i3#ȿQ#0)F#FrKh+{Ѹ@ O  1B8#??08g+HFFFE} 1B~ )r0F9FOG(QKh#(z1+#1F!O HD8 #C ZE  ?t ! "g6  "qO #h(F  a0KhDEu Fv0"!]60B$H"{& ")Fv-H_22BuZF#aiBܣiN a0 1PB`1h" =h\T!iQ"2A#3/&DT&S&0&t0&S&-AFKF FFh+ 8ȱ")Fg(@ Kh0D(FKhDB DT&/&0&pFF*F#FOHqp@-AF MF$x$1B  2F;F $40&O?h/@# F!PDT&Ki(!h,!pG/&K(!a,!`pG/&(FK48  /&(F HK!F8  /& ( ! I#3` Ch F{).Ѓh#\)   \B\A` h+J\B[$)3`\+#C`O3` F( F0 1pF FF!*F F#hBF0F(p-GFԢFLFF0P+ 01;0#10#0({1F(FA-JFO0F 01[h#0H nF(05HN0q0 ` o)F06 1B xHj 1BFۣitNh0rN+D*FO1&B ([eH3`:05#01.gcKh*bKh):BF;FIF Gi+`iBhD @%i@8U 0BF;F G]J)@ F \*h;hO1DFhBO1a!iFi2FQ (FS<.#h(#`#0;5F-u0Ihi hI\iB"iR#PZ_./ѫ%E'L#h+.@0+0F(0FBF;F !GO300 CEE .Kh+ Jh*@+>BF;FIF P/&0&0&t0&/&x0&S&xT&&&S&DT&_.hEF _(E0FdPihDW1F F($I0"h01+0݂B4A!FdJ)F (~<,yI;Q#B;8Aw BF;FIF0F#h+PJF)F0F)d  1&5-AFNLFFp . (#! . CKh+BJhC0+ #x0 " F0$+5M)h9:FCF0F(R Oa$1+ +0F=x8FAF+ $1Y#DB$aHEXH#I#0$C$1#0(+h+?w$t/&S&xT&&&0&8%L0+P8(F/&-GF@LFF8 (%#!J`8O8쐙0+2;h"h3DܠB߿ch#`ha;h"h;3DBOܙ&Kh;h"h3DB#" Fw"iFGZ m#hZ;h3DB"IF YKh+Kh+Kh+ Kh+и"! ?O2! /&0&S&\ &` &DT&T&S& I0peCiB0T# poCD# 3/&KwYcpG/&K zKh+~ # `8#B ` F@BDRk `ZiDihP"`\/&$T&K" " pG/&??-CFFO0F)F(AF`` -j0 0"U 0;`.4`0;BL(8a 0U4F/&4b&(-GFqFO0F8a($O@h<U (FQ0Ah#D3`-0;+`ѹ? ,( 1h:D DhB@ h<F/&4b&-GF hFhFO D/0h3`+h+`"F!VFGF`"F@F4O BFJFFPFF?FL#q1n8FFiqO2O3W(13/&-C NoCL$L'F5h3`H0BܬB5` ??07BF`0&&/&8 FCFO08 Fz0 (#xCH!F0q " FFj( CK 0 KB hB Dh2[b2 3&Kj+ KHh*J!`!`pG 3&PT&G/&L#j+3d+#b 1''b]ABvH9F3O3 3& HK!F9 K JcbB  ! Zc3 pG 3C <`3& 3&`C&-AF+MF,hB0Bp+(kxh+c.aH``m Fj@Fgjk+hFEѼ:FocK``0BB$hhkO 4dBp;FFFFO 1F FsF 3&-OFWKFh+iб??c(q@PUE#кBs ۘEBF F1F-h-UEO 0  2h bEA:@FаEu+FJF F1FKOExI hB2лBr ېEBE F)F-hB 8hbBA/O4%FiEBy"F+F0FIF# FF)F0F Fѱ??6I (iDEBx # FF)F0F Fѱ??>i $ 3&4b&-CFTF FoFF??.0BEF#p JCc`Kx8HxHLdT&S&L08(H!bK"`pGL&(Kh pGS&0L#h+ `S&0 L#h+HiF#2##`S&L0 L#h+HiF###`S&M0 Khs Kh[j??ѽ@S&&(0 x J^+pKxp]KxiFHP! HMp()0$NM4`,` x,+ I#H!F0`x,* I3H!(` pK! J FhKhHS&S&WbMzMMM(0Z09$?+0GK`0R++D+++BHiF0je *'*-03EZ+-+%У1* ;Cr+d+W+^+w+@@@p@`@@p@P KhQE#0 TDF!PDK!DN!DR!DW!!BH H )!BH-#0 piFS&MMKhSKh+Kh(Կ  pG pG4T&S&S&Kh(KJhhDpGl"iF `FFx*\x-(^/$( (٠ ۲)F(+(#3eG#F F(#x++K2`O F29($/(z$ 7 Fa O O F FF,S+KQH:n(0+Xx-(3+(@3% FIO@1!xF=*phOr@5HK3a O O -Hh;+ :&2U`ci!F G,o7[ 2-ѻ;#;#[xd F3x *iRF(x+"QF%HS&oNENNS&&𵇰#@FFF(FgH-hZ aH=^Hor A-x* h;+)>ic-ci+-  G@-hrFh+`+f-Уh>K"`-&--"ih[ `2[ %`---"ih/;#`%;#[#%`2;#;#[+H!c-- -!+#i`H!OF+#iih #ih+H!#i!h3T#.?~2NNO/&OIOmOFhFFxF0; +#O F"x!F40:ײ / "+1`M#+`8F")F2O0+ܿ3 PC3KhKh(   pGpT&S& H K"` L#x#i h`h!ciFG$4OS& FHx FpGBЁh ;B$0 -O$,M#FF'FF*xb+A#`O XFnh$5O 1hRF@F, A8(ټ- IEIE 0h7F0F#F@DBDAh O )vh# `+?h` H8((ĿK`a\!  pGYKhXHUK" "`"/#Kh2|! Kh Khd U K KXhXK"`|T&S&Y&|! &Kh|! FhhX $ i<кB`s0F`uBsh.bEsF FdBsDh,`%dBsۄh, (F`0Fh h\hZPhB S``Y``` `!``#hZhB `S``L`` `!``F@h1 # Fc`@ɹpFDhcBv! 0!F0F{#3kh&``[`#l`h0 Ya` p&,`-AFFF F`"Kh"K`T,`hh1#k`T FA J!Fh`m `F'B#J`h+* K"`+FBF1F F (O0:F!14(#TT&a&-AFh F~FŔfFRE~!Brڱj iBRrh*!iEj~EڑB)5BERE~ ijB RBrڬFFhhBqE`E58F#hp`Fa `a`#ka.`Ɣ)h9iaBrEaE##2iRQBB}8F3i`F` a`5aKi+?n hXhB hFBTi4 FHaPa"ZahBсB8Fmh+h"8FZa"h[hBJa ѽAJhBћhB8FhAzKhXh{@ h8 a&-CF FU#@!GtE+hjhXBEњGs2CB#tiFHElhGt  5a&-OؠFFFh+Y2h*VLO0i[/:!BO$a!*F9F*F9FI@000 y_9FO$b2h*Fn3hBB4 0"#2"F( Fa&K""`ZapGa&FKh Mj>#bKhb FO?? Fmp4;h;BoO$/&a&$&&2K-Og??W-J h,KhQh #Ob&Kh ]%,F0;B2(C2O F??FF@F[Es ۱??ІBw XFQFU F%'DF$&/&&pFh\ KDD  p`0 F04Fa&Ha&8F L 58@ $i!8@Hj[ ba&JbH b&8F Fk 8H*F#Fd(#BA b&-OFF #dK2h QbKhaKh[YF F]KhF\KhBOrr 3OxFAFFF??': 2?? K3%F^F # GKh@ 2??8՜BF{ ڻ B s 4+6 K )ȿ4 FYFĿ342qSFF3H??G8[X??FF$L??FF6+VSFF;hLFFO FHFQFk'GF0&&8T&S&S&4b&Khk-mBoJFSFAF FYF({ђKh3Kh Kh 5Kh*ЌKhCEKh+ЇKh+ EKh+E)FFF 60FFtKm-@?? ЌB{ #B{,&hb"!MLEK{ `H0f0cMFVFLFF-i-(PH#"!2( KqV ; +BKh+ KqV 2F(p+H!*E% F0J[YF`R#` Kv##F=Ev FYFS(PO Ku##F&Eu ڱEK `"K` 5E005 K# XPT&S&S&a&S&xT&S&DT& b&S&0&/&7+!+! JFWCH7'FFR#` Kv8FAFEvکEO7F7x5FFO38F F H*F#F(#Bt(F!F8Ti b&8F F H*F#F(2Bt(F!F8S]hB4FF b&FF#;`"Kh˹!K#??MEu ۴??(ЖBt$F FH`??#BAڀj /#;` Kh++Kj+OpT&a&S&a&pFF +xKm,K"eK`p%i F F0,F! D#2F)F3F`a#0 Fp@0Km#aa&/&!Km8  a&-OFOFFF;kh{k(OJF+FF򲀋F# B@#??е??ДBuۉI Eq  1U??𷀀KNF FFQFhCEu??л??РB{F]FEqȀh ( O #C#A#oC#C "F`F +F.(5 # ??yЂBsrBAsBqm8a(f#F??F FzL+(K #YFF 3FOO0FQ??cФEqdNEuEzk0KhC EOqz۹ jfFFY&FF1FTNFFFQFf4FEFfFF#n#??ЖBx.x0FAFw`#0FFAF??Fh;c{cEz+EFzFa&d0&0!bT??oF F(FO1!F >0"KbKh+ѽ@a&S&8! KFh~F M#"F(CKh+ѫj  8 a&S&L#iKh#`Hh@a&TT&a&-OFF  x+NGG8Lh{@ՑH!8FFHn(O9HF M+h+ЈKh +h+ѣj#bX#bF(5и@??F Fu_F F0FF F#FaF FWѰF??+Ѹ%@F+FѸKKFhFFF0FF F??06BO4%FE??FFѺ?G.Kh+-Kh .H!2&4F5F FO;#O2)FO3LFx#h+Kh+? { ?? ZFb#h+ Kh+?B@E a&ibJbS&T&T&&8T&b IbJhC`Kh@-#4b&T& IJJhC`Kh@I#4b&T&   I, J!FhC`mKh@#4b&T&FбI KI h+!I ! I@ F !F ! !F !F#|&I##y#-K-Ah,SСO`B! DQ(F)F )F D!TI  *K"`MN7ht*h3hBEџB 3Js[`l K"`b Kh#A 켽4b&I#/&0&&&T&-CFKFFhHFl)FFFHFTp3+] +@F9F 8b&-A!F FFF0FD!D1F`lZ#wa F(F0!D)FalF8 M,hB K""`8#hS``//i/, F/)! 8b&-OF[OMhXI `F h/SMXF#  `F BFOaHFhFx@F h+;h0F+`#k` M0!+RFIFXF( 0 + + `Fx+FF#` )#!p h `x+! FsFaF0F>{h`C``hx`3`F#hY!`Zx^*!` F"hxEp,$*O3O O pF\(02B#`P `x,  ~! 98b&)-OF M F  MM,O`тKL `O  "FOaXF(b{Kh.LxKB FxP vHAF^(sK<0FS$(F7F@FFHFF8FTD4! DfIKFBFFB8F/aIPFxFPF/,VJhB+` # k`XFб80 + ` XFF;IKB Fx(#3`p FoJ (0320[#; xFF1+ 2@xF0^20^F;X2 @320X0FF)12I!xFF3)12IF;+320[O *2x*И *0FHE0FF@F{h`C``hx`3`8b&! @g 4b&b3b9o KhI F I FI FꨱI F ꐱI Fx! F(     ! bbbbdFF FY( ( H!@H!bb;K-Oh{FT F1FO !,аFF0 F1FUFF5G??#H!fO4&F Kh+JFCF(F9FKh+ "F3F8 F1F!jFoQF #Fr3F"FPF/oPF/l+LFFF8b&bPT&DT&4b& IF%4(F O* 4ChBаh43F%: 8b&! IF%4(F O* 4C^hBаh<3F%: 8b&! KhpG8b&KXhpG8b&Khh pG8b& v8H!t( !l(cK`Db&pG pG LQ" h 0 ( +#(FDb&)ѲOs` )+ #)O1BA #3`pGFh/#3`#C`pGCh#h;C`\pGO0pGhpG!TgRcA(!g pG2BF F0&F'O a|!h!hF)bh h/U&`#Ya`TFFFFF$B9]0F4"B`-GFF# FD DR@F!FBBBF#F8FGH F(@(7(/(? pG8+)08pGa+)W8)78-AFhFF`x*"""D?(F4BF ?(+ =pF hsFFx ha;+!# %')"!F@ p ""##p4 4`+` # # # # #[ \-CKCJDIhh ~ -!Ix,[,L[-m pDx^,00KLpx])0x])p 03F-K-J/Ihh[)ѐ.ɲ)'FOFksF].kѤE 034F.KJIhh4F\,FxK[.0 pFB0 Fn. $0 p\.B FpB#0 pw Ft&xt&t   J FpFhF F+""p0 JIHh hM(=Ikcj%c%hcej9F@FrFj3b+ј #*ј n*a.j{@3`cjjhcbjcm:x#*Zxn*"a@F:F!*7 ce#pj3b#3`EFxB *+!:Fceej""b)hhBab?kpj3b.#p"ceBpPt&$ t&%Lmchh Ch;C`+ھLCСm hZ`xPt&-OFL Fm#hhkchI |KJeX3eK"c#f#cfPMmرCh;C`+ھCСmImmGF@"k`hZ`xmPE p` (;оNp0۱H2~I k週|I kXzHp4tH  #p0p4m@HEо&oH!k(F#ehHp##fcn#h[h#`#h+hch c+9F !k8 F]I |P#cfhYK F XIXK|4chxObNHahLHObno"k NI|!kOb*!kOb `*}F `}&AJOa[F(Fo(FmHEо8I(Fe(??Bmh Ch%fb(I ke(!kH#aK\#f瘱nD< + E CF`n0F*Fj 3bPt&+@g x&t&t&OXwa$g F- I"F || F @F- I"F |h8F F-Q(I+F"F |X8F N F0h-)F# FmdF;F)FF0` FmZ0h|&])M)O&khB&Kh@>$KhZh+5Vh.jI"FF | #*hsCX+6h!;h@h$I@hF(OR#F!hFF F;h!hF  3 ]|&t&t&\$FMF(h I |`+i" r libF2H( h_IF |  |&$ -CFALAO2DF[ij2B AjbiDba"p&--\-Jx8h 0@0՘ \*&*Fij2B AjbiDba[i2aAF!"iOR Jh??R??i-j2*DB aj)DbiDba"iFR *F1Di*DF+D|&o FBhFAiF*DFSBAAai a `/*F1F#c`D2D"e`ZU-OJ#L`H!1#cKh-G#dP^ k~@(-h.eh*73h+ эKhrhB#` +bk"!kphعhh*ZhKhB+ }Kphh @ 8 #`#d(h+ak!k@h(Ыhh*ZhjKhBhKh`+eKBhhBW*[h+h+bk2F!k@h+WK@hhxBxAz:w(?|+~=;>+?wR#QRGGGGGG5JGGqJJGGGGGLG;MGGGGGGGGGGGGGGGGIsPIMJGGcJJJGGJGLGMMMMgPGGyPPQGsPlbhB! hYCZdA `fh #"h!sC(i6Px``f`xt&|&|&Hd&# 0h˹K(ihKkhC ћM!bk k+hk)h Kl+g(k+ek5&kj !0F#cA0Fbc*#HC#IH"<## H#|I}H"/#vK(ih0p rO:htKB<#A qH@x38p# kI (ѽ"0+0"!&C06B9h_H9h$ 9h ;h[)XKh,h+&h-:RI"FF |QF-FP ٚ0"!|O  06B9h=H9h$ 9h &D XF-XF-0DFB9h^F-H;hJF!PFXF-BF&H\F06B9h&HrKI K8h N0O B9h^FHZ F+I8h6[EѢ lt&ht&|&ȓ}&g ht@t&\3# qKkhC pN!bk k3hLk1h 2iH!2 #cJdIbH#"`H!(I8F \`X.U(FC,cZh`B GFFFg`F;!+!У<Ѳ) *=<h(I*F {C`hYChChC:+h+ ;x+Ч`#0hBC`.ch+f`:!HFXF(#;0B+  HF agD}&&8F!Khı`h )F(7h+4 *3!K"i0SBSA3h(F8K"i0B##K"i0BԿ## K"i0B̿##K"i0B##$hD}&u'"0FMFI*F {iF 0 I {ObiF F F M0C K : * B² *I QppG@g g I0;0+ B0Z "ppG1 @g  2L!Fh!+O#w#|+##t|+#t#~+##vc}+#cu+#wc~+#cv}+#u#+##wc+#cw~+#v#}+##u#h#Oc# C SC#`ch#pCc`h#\SC0c`K@"FCsC`@L~&K0hci1]xx(+h(#H|~C}0#+#F۲t#ɲv!ҲBu"{'L~&Kp@q`hA`B\`L$heiDd&x . dx<" pB`Z`%Zh"Z`A`pL~&{'p1L#hZi5kC#h,J![ikMx*N%3hB.#'Jh*B"hRi( !J!Md#"hRi, J!MZ#"hRi40Hp@ #h[im)FObh J!M8#h!J5[iM0IHx+p{'1U~&~&g S8FH`3I z I0"F:HJHOqLM, F8 !(F #p+x3,IH6L@g g \L}&qX!H$( t@FHx?+Cx0!FOd0 F/!D Fx(Ѐh;+ H!F H!F6h2#`! {/IFH pg KD |<0BєB4KFIHKh[i1cxB [x;IH@K,IH,؄@I@F Hu,I H"F I@HiL~& g {' )<FvIFHR g 7F F"` F #xx<#`O00h"+ #?? O0 FF*hiF F0I"F {&=<#DF%pBݜi*5XB2DB<#? _ 5# 2p! h3l@dpG2p! h3ldpG2p! h3ldpG2p! h3ldpG2p! h3ldpG2p! h3ldpG2p! h3l dpG2p! h3ldpG h+#`pG H`pG# K`pG`pG8F K Jhh@!B - ,O@C#8##T&&#pG `pG# `pG# `pG# `pG# `pG# `pGK J`pG&hK J`pG&K `pGrVK `pGK `pGK `pGK `pGK `pG!L0  &# K`pG!L0 4&K J`pG &rVK J`pG &K J`pG & `pG# `pG# `pGK `pGK `pGK `pGK `pGK `pGK `pG K `pGK `pG&K `pG3K `pG>K `pG=K `pGHK `pGعK `pGފK `pGN:K `pGK `pGK `pGR@s @O@/g b # "O1=]" h@! IOb@r  &Op h%*O!!D IOb@k  &"I@K w1&I"Op 4&OpK%*O!!D 4& h"H \"I@{K w &I"Opm  &I"@ a  &OpK%*O!!DM  &I<"OpA &I<"@ 5 &I<"Op)  &I<"@  &I"@  &I"q  &I"e  &I"e  ^&I"e  @&I"@  &I"Op 2&I"@ &"I@K w&I"Op &I"@  &I"Op  &I"@  &" hOpI+##Du & h I 61("d b  F#IOp程&"KO1h#|1 T&8" M F h(h|!(h)1 8!hFT&K hh T&p FN0h)1; @N! "O0p$ h"F|Ar)h0h#"0h)h"F/ FT&p%N Fh3h|Q!h0h*FS(FpT&F! F! F! 8 F(F!CF(F]"!F 88 F(F!CF(FK!FB 8FB!F( "O1 FFw  K` &K $`= FD&K $`1Y FD&K!jFp #0Q].tgzK!jFo #0A].tgzK!jFf #01].tgzh!@JFc  pK!jFh #0%].tgz$ F ` F $ ` F $ ` F$ F `$ F F `  FI `  F `  Fw `  F# `  F `  F `  F ` !Kh,!F  T&!Kh,!@PC  T&OK!h,!  T&O@K!h,!  T&! 3 ! , ! % !  Hh vHh Hh   K"`H &}    G z 8" h@D!F4; HhHh 8!F"H}"!FH}"L@I4; Hh Hh A"H}A"H}4&N&"L@I4; Hh Hh A"H}A"H} &&&"L@I4; Hhh Hhf A"H}dA"H}^&& I HR0 I"d  J#IOp1&O&& I H40 I"d a J#IOp &'&& I H0 I"d C J#IOp&&&L h( h"O1 T& FN0h)q? @N!"O0$ h"F|Ar)h0h;F"(F FT&# `pG# `pG# `pG `pG-AF| FFF@0B̿iOiĿ 0ȿB-$KAiC#S)Ѵ0iB"-aҲw*b1ʲI7﹣k۱2F)F FG0BiAKA(1x"+ Ii78FiF0FA2-OFPiCF8`h@ h(} FFF ! Fi^AFZFA>3x+sFO2# iC8 0Bȿ8FљBEF BBڐBFDNFBE# FETڣj2F FSF FF0BѴ0+#K*Fi1FA,"iF80*FKDiYKiOGFHBF悲"r₱FEڢi 9[hSX2F9F FSF7^FFpFFF.F0F**FIF Fp@"F)F59E< KOq%*""Di@J@ JOqJ@IHLXJ3K@ FOqJ2J@h IKOqF & & & &'&&&\F)J048@"KOq%*""Di@wJOqJ@IHXJ3K@ FOqJ2J@J@K!h+ ""KWOqF4&4&1&O&N&&&F )M"&<@DhOq"J+##Di@J@ JOqJ@ JOqJ@IHXJ3K@ +FOqJ2J@J@K!h+ ""&& &&&&&&&&8F)70hOq%*""Di8@J@r!h@"hI (3#2Oq@ Fh@B8&)  JOqiw J@ JOqJ@ JOqpG2&& &&&)  JOqiP K!hJ@K!h+ ""pG@&&&&) JOqi,JOqJ@ JOqpG^& &&&)  JOqi J@ J@  JOqJ@ JOqpG&&& &&&) J@ iJOqJ@ JOqpG& &&&)) aJOqiJ@ J@i!pG2&&&)) aJOqiJ@J@r!pG&&& H`pG H`pG H`pG# K`pG `pG `pG `pG `pG `pG `pG `pG `pG `pG `pG `pG `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pGK $` FD&K $` FD& h+#`pGI"Op  &I"Op  &I"Op  &I"@  &I"@  &I"@ s &I"Opg &I"Op[ &I"OpO &I"@C &I"@7 & RK` & HK` &I"Op 2&I"@  &I"e  &I"q  &IOb@r  & F N0h)q? @N!O0$ h"F|A80h)h;F"x FT&-AFh Fpchc4ihF{(!0F``&0Bܽi7Yihdpi BY!6ǿFi7 j8iD j@##biE i@#aJ'F`#B7<2*/i3aд)FB<#>^5# ! r@Q! l@Q!@ e@R! _@R!@ X@S! R@S!@ KIHd g 8!L#h+87(6=Z=4IpI@"! I*O09O0@|M(hB``(hB!`(h7@ !`*- ap J0C/B<##` 8  ~&u'# -OF,򇃞KhB@iS$@,|#! +(Os>Ej#i FG#k FGi*@D0 P.O O i* 2B3QZ գFO `hX   h0x+ppK&_F&`O FB3FF !0F p  (0F BFF #-o mBBF 0 D PB+ݴ D %u@ DB!I"+>V0 qQ ;I;H%#7RBF.&*VF  0E&>*,I2F*H0KF iO  HhX+ vBF  0E?"ѣ Oc 5P-um8DCF*FQFDta= I;FJDB ~&g x!6IHHO1i9iO1@#մ QFCF*F8DD6 bE!jKhD F$@0%zs C+, F X@00h3BۏI i(F0F-&FF+FF+ E?8h@76"FSK8h@+F"!8h@"!8hJ8hG\8h<'003x(q(>(1d(/<(!>K[h;NE`jO F *  u(XEа ڰoqD(*I @SB+x+&K[h;D=E0+?  [R#s"ri7 0PAB `p3D7D!qB9FBֿ2Rؿx(хcu'g o u'~&o ?Ѯz(`(x(8a80BĮi[? (8?o|`D(^Z?G+?R#G{Ax{AxwAx{Ax}{AxAxAxAxAxW{AxAxAxAxo{ڰ?(?h?<(@0L>( (uO{pD@SBj(F@FEf@F@8h~&KiS 0YpG~&(KhBiS pG pG~&-OFFF*$ PB*aF $ FD!m PPO U$()Ky.FFh.=320[ Ը 7I .F=D>>.=320[btd-nT ѹRFIF8F28FFBnb"D<"##[#C RF9F#;U 8F O)KERFIFF~&zJo g FMh౨`AF0FADC4+hB F)Fdhh)F"##8F~&F M(hAKiO3+`" FFBFO0p#"#N#FaF (` F,hc I Ff 0b 9 ~&@u#BpF M+hZЀ N2jB 00iB,hD Fplh9 ~&Lh6"##~&Kh~&Kh6~&wFUk F1F*F p@pGSK!F*F @pG R]pGF F@FHu@FHٿ-C 0FFFX F8F ZIF*="F!c+FcL&-OFFF@AFA-F@%*)FF(FF+x+|CBw5Z'D3DB~۹?dtd  O !(kѸ*FO.ؿAFܿvv[Eȿ3FCF(P+FiKIBF%F5F*9F# F6!FPFCzPF?l FD(F0?d F?b'kx[DB4''%F'}0DX FCF !KFhCD8F F8z?BF F?J"F F6 FF sCd`F F8F0F8R F`?F0F?"[pu'~&L   &𵅰F F FS{9F*"F!c+FL&-C 0FFFX F8F IF*"F!c+FL&SK!F*F @pGI&8MhAFhA" D8~& 7hFLHt> V0&b8&*~&g A-Oð5IF8F(R,` G*F!.IFF-H F) *I(F~)\ 'H똻@t Fr!FFFXFF0c 'DIPFX =*4I FNID FtJF!F'Tv2F!(F(0FC$g PX\30Q# -C#M`F FF(;0F F 5+I "(F(h #`9FhFf%IhFf)FhFfhFZ( F(1BK@F`)00F Mh ``h)(``hF I((F`I(bFKhKKh@ <&&H (H } @(Op@ b-G -PM$O3+` F(> !F?+h+5B'iF +Y!#]" aF(@݀ F(@ր   !F^ 1!F c(,`6qMF!F(h0(!F K(h!0(!F @eKh+ F ! 3 B+h"$!(6|FV*hX VI2 <(v+h)(k(f (?r_!0)<F(VB"p"6B.&E<F.FBHOOp EGӡE1Y ((S (!AEE(U!@B1Yk1"BEE(p3U"B2U& H'(F)t/86V h0G( f3kճnczRnhR1 [h &T&,&( FObF NIOb Ob `BI `Ob h (  ` _I#F"F DDDD!F2 a ȏЏ FObhFIObhFObiF Ob I  `  `iF  ]ȏ0P$ C FK ` F GF Fɲ|(;L#h$*!P*hѓ)ѹOp0*]h0CG0#h$h0G#h$ )(>(9"H+(4!H&Fx XKMhFH"F!F(hH(h6(hF#0&T&-OFOE 3x3FxF3 **O0F pO [E ZDD6  B5OL`D %)c Fx* * .Kh#F+*21 P#F)ЊB " Fl B $B5@5H`\+ 0+aF1 + Kh#F10IԑFBcc*ѻi :F)FG(?z3P,hC) ThPziS)Ko 7hFLR%hhFIF  hV h##` 0IH `xI(FhFIF(F h:8h)M J IF[ M8&*2p i F Kh;#+ *FIF0Fp@K8&\&7hF#L%hhFF IF(F h hX##` 0IHF `XhF,IF(Fn hKh[h)JIF[ h) IF HP &>O4&clg sF5M F(h5!(hA(h=,E6 i!F ?@d _?t@ X!F ?@T1F!H4@ H?^a 4tE (h@!"bC(hBLF0IH !4Gh(h7F F70(h>F F?" FFH FEd Fpu'g -OF- F F1     "YFHF1.F0̀ O FFƼƜKFNI3hI2F2h*ѠIPFP2FI2h*I2F3`tKhKhCFr(@ 2F!Hj1!0F((hE60#x{[, ̬ 0<* OrB ` h(F&&0#"2%K!" S#1 #IO3e I Hd Kh H^ )FE F 0@YC g M& -OrFF(S+!!(!FHO0#0iOpG4I(p2F1Kh(0J(0I+I(qfF(O OW 8F(F8%0Fh ?F #cU0F,Ѹ=Kh J(I(F{Bػ F(h#0O5 F9F(:F(5qn$&5l.-OF'RK !F.@bI"F w'-6)F !0FnF0F5 FOAF(FI2FID3F@FI0FbpB x%+@+*!:0+x'+5<*+//!PFF#pPF`F߀/#;@FC XF(@̀T'0EPF(XFpI(F7.5x-D'P<0I (F(0#(0*0P#*0oɀtM.hn"0FG(hEp  !FKFFiHhe.@@ F(F^O@`F(F@d;hBF !F >r;h.𺀝BѸRH>? >O?@E@ @;hB(F@4!8G >E:HCh;C`+򖀸<;hB(F=l @8h58h:?bI?`H>0[h3`gE a<,%F(qU H F(k0F^Ыr(b.? OpGȓp°@(FFp+xc.!(FF0H")FTBp")FkHJH"!F~&&-CFhVOFB# F#p_-и/-у k20#)F@FR[#1) FJ+F4"ԑo F!FFF"CFА"!(F I"(F/a*F1F F6F Fn,F F&pM(FF@)FF 0˱) )D<.+(`I@H\I@pVHp~&H&&p.I "@0k\"F)H)I "@0kN"F$H!"FrCF)PI"FC   pI FF F}MN1l"FH\1F0p)F" H5F H"!F!i&%i&&8i(g&&-O6]LFX6 +@J© 6( |Kh|Ht{I|Hp  Y'+j pF;x+XFD_E 6ROs82#"S,:iI8F9FF0Fy#cIp8FaKh0D[Y sOp"1F05F F 0F ( \23 P-0F+f'0h'5r!(FO3&%ѩ9OsBH0©CF0# *s:IP 3POp(#X6# K!(F'F 0Kh ~.NF r!`3#rClB&@u*FcO3u AFff5Ft Zt tWO3;`<9F ;hY( @F' 6]~&& g 0Ho K]&A&C pOq"O HFXI"HFF(퀲I"HF(7ѮK_FHR!A`@!J#A0ЪWchK@-JI[h ("#AF0𴀙HA1s+@À1l+@𾀓J2h3PH©~n(@𰀍IrF(@&'OrFJ#x FJ#w FFP(\8# \8.@wJ#y F-'tJ#z FrJ#} F\8nJ#| FjJjI:xiH+ FhKF< F-9FFFW  FIKQIF2:K' 4(? @F'GI /B l%H-@C}v HP")FPWcWZ6IC   J0j W"C`)J~ #F;%I%H'I#Hб&I H먱$IH뀱IH~X IHx0IHt(@#:4ܑ|6&o ~&&&%&C&v&j&&ԏeiعHOA(ЭJ# F\6+ЩJ# FIHF(?vGIF(F*I8F&I8F"I8FI8FJI8F[7+<ВJ8FI I8FI8F8F&I JI (:KAJOqAHOA#\8%XOp0K JI0'PI8F:4+ЂK Ir|(JAKF (ݧChCh'N\8sJ9F C\8(9h"nH8h'kH !#phJ9F (9h"eH8h'ybH !#p^Kx+\8C\8[J9F (9h"WHt8h'Z0sTJ9F z(9h"NHb8h'HKH !#p0+\8C\8EH!#x '\8C\8>H43( ;I";H2:J#{ F?+6I"8(4I"FW  F#K)(IF2H&G&֒ڒג (6:&@U,9&&ɓEC&v&@&•~&&D&OZ֏0+>lImHFpkKh, $!F fIfI8FbJbIF@Fy0#_J@F_Iq0#]J@F]Ii]I e @F3+C-wVMosUI ;2'5QI(FOdD# "O1 SF#(KAFIFd,)Fd UxR `?I pHU(h}l#x39HF7Ho﮹W5C4I 3J4I 1I v XfX6}x+<CF" .є4S!J0F!I"K0FIr-?wo&g ͖&v&:%&$<~&C&ė&L&q(KiHpG6&-C)}F F.HIFF^(<є3+83pD# "q%K8F2BI F=I F{:I Fw0#8J F8Io8J F8Ij035IF F`3I FJ[ F|#I T.H-I.HY\63,HSI+HO(Fb Bp&K(F&I2$H;I#H~&T]v&&j{d&&:גڒ&٘&C&:N&"pF[ - 3]b]*#D\% ;F+F"x _.9p0"x 02,"x02,"x02,4B#pp\*9F+Bp0F9+-G%FFFhCE؅3hAF0FlGF,F%F 2h)0F#G(9F,C;h8FG(;hJF8F0G(,FE(B(Br۠BA O0 hS20K`Ch `pG h zrpG tpG-C -FoHO UO F!FFF0F( "d+x++ m mñ10cj*j+КB ؂kkB؈B4O0 pGO0pG pG-A F]F! F,CF,OR##)Fc0F8FF_\5JBJBѕ0+*k\3B I#F2F NI#F2F H ]TT -AFF F F"IH!F8@F&d$ FI(FH9F@F.I;F FP F&I,.  I"F@F +F:F!F0F(-;h-GP'[hFw8F& F@&F(Fc#hZhBh&`$X6IhhlG(#X6RFt#RFl I #hP":F(F6H&pFiOp[+hzFS T"FIF0Fp@L \h-AS1pUhF;h8F)FlG(I;h\o)F8FGF#K#BFBF#J!{h(F SI"(F. "(Fh(LI"(F""!F(F(FH0B; Ic^ I*Fi28&^z"8Fi F[Fh F#`#8@ƽ8-O'F FFFE!8F&F(6&0F&@F&`h8 U)& 0Bah# "hR3 EBhB3B01F@FlG 76  !8F&VF(FO   B;#4K"1FOp<#2#:F-AF< (F+ah h1&(chZ `b`@3S`|U! 0B`h# "h R3 E B3B0HF lG h J  3C, 1ɶ Fh/ *@B(аOp( ))@@Op()@"( KS K(FpGHpGHpGHpG67{}8F K)FJ#FOqv";I^d8I^(7I2FX (KO4O H# 3!8Fo6h0F>&Kh0B\310[#F!JOqHFna(hkh0(`8sk` FOFSFcFs+vFyoz}DQL&Κ\o &OJ JF!0F x"!R" p#0Br#81#H2BFJ F,0#1IOix1-Oȳ{1 4 7#@F!!9HF#A!  =#!O K4O #3!PFo0J#FOq0FUKO 4O#3!@FoJ#FOq0F8Q`&𵅰%FFH*F!U&Y0%NF`FH!U&J0 F&O I Fc$F0FG( F&A I 6#I 0 ]# 0I]q-O])FF&0F ]I@i^(њIh F(?ЖI0hF(=ДI-@MbOb)h1I `b)hOb `1fh0FEv]`.]0a0BXahOb)DtahOb)D `lH(ФchFx*ruK ph-@0$(lh0+gAFGFHb0$Q-?+h&'f"(Fr bxOcG+h"f(FroOcG+@UIbf"YFai"HnNIHF&F-@h aF(?9 bhDI(F(.-\*Xx3F3+ `! fFE0F1ر10F,1L# Fph0SAFGBF{+h(F0G7vQ-?$(h0+AFGCF$QXbObahI `bahOb爨"YFQF(?d6̵T&&I(F I(FI(FбI(FI(F퀱I(FX"I&H")FB IF4IBB #[#Y-A'$ FF`@m:FF B0K3`'8FGR##"#(GF#F@FF8@#3`#h F0G0@F0G$A%-O]% fO SOr F:)F`>Or)F~89h¨BM̿!! (h:ZBdHe(h=r k|!F O3 ],ۀcOr`"ZJ`cO2`" Q+  xO (# # ` &1FFF) B󱀹 sЦcOwP#KsK`coC"2ЦcOwP#KhK`coC"2#!3'1 7:#O3?F?~ gO: Y [TI 3@FO300X?dbR#(Ѻ?#"!21 #~3*FSF?FPFO300ZЧGW#LF@F,Jк?GOp-L"F""*K`#"F1 б OOUHH  @%05,3qO +N p ,TH @"02PFKh*"`o&u'@g AD T&"E` SEªOsM$ #'F BKh+>ªOs$K@ K"!Fh#T }1(`0U (h""0"!FH,1,1 101$141L#(RR#8 1$!YC#JCR#,9$)h1(1)@.,L., 101$141(1R.R81 !SC$!SCRBH(?|  Jcn#)J!(I0FdI&Mcn#%J!mC!"JbL#nC!Jb@m+JI+ FI0F8lYIMJT& ؛U&:@қOV]k2dfm;"n*SC!J!| I0F MIAI0FMI:I0FMI3I0FMI,m0FKJM)FFI!1B""F!FOO}nhȜ r-OM+h*afHe>IHOFIF0F+hI3F@F섹 9hH,!F  FI(h)q/x09F(J z|b蜩PFbI F)FPFF#hFBzI 2l 2 (n 8FbxFFXF%pOp*F!sFF0F%^%gI:F F^eM+x!(FcI FSbI FOaI FK+x#[J F^ID#]H#Fl8FXJBsgVJWI F-VHUH~UH{+xSHvSHsRI  F: Q3F~Op [0jhC j+km+k +m7hB؍+hk y!#h1OcxJFkG(KF# +~  km + +Q#QA     5Y|pT&H&6QmΝ^&Ϟ+17@G:&&͜OCFPIPFJ()mLIFlKH@JJKM2FT0FGH 0FCHFJF F>H0F5F FF 6I1F4I(+@г.OܰCFzаX IPFOCFl5 `[ ObK FIKkh[ +RBIcC FIHO*hCFe#cN J&ܜ֜[Ҝ&/Thbn-OF|M,@e(&EFU+I\64,ѫJIN 6v!60F$F0O4 F MԒLHR Ih`HFK(lcc H<,eTDO  XIZF IZFKIZF;~Ka``~Ia~K ;84vKDrFD ЉdETAD !LLAPAi#F IF(FA0)2BdFO@JFE"FCF dI#*F0F }eh 2F Ue(F8]a;+Sx+RI$0FF0F-$1Bݖ056 * +s0:F?Ia"FtF3 KZO(sE 5IOb`l0O9~:F,Ihh*Iht3`h3`+ #I"#HVF(!KhJ h!* @qO"@F`O#O ; A"T  - Ia#h:Fnh`d@edA&&P&pC Nh kh1+D(p0+05 F3D A@ C AP&F"!FF"! -GFzz?K"?L!?M&h9 1') D aD!DB @  #<1L P D T PFHPFLFHFBF(FD4F7FPFBF(FT4F>FHFBF8F(F$F7F!KJB(MFF@@FGYK"K"6P&7&Z66 FiF8p@XBXA& OAJxI YK"!H`KJKK J!H KH]ڿ ]^&&& &&,&OApMdp9bhC#K"F#!30F$Ap KahA @0 pP&,7HT Q!FxnF HHI FZ F@#٠ޠ?FR[)F|" I*F rI#F #0@pG O3D( K J L` J!F HJ!FH &]&&,&MHiFz눹 I*p I*@ M O0 (VMHiFzr( M 0 O3+$ F0K JI.F(K"M!H`KJK K J! HS K&&4&&& &U&,& O3( K! J H KX KJ! HKP ] &^&&&,&J#\3!+pG pG\&I"\F (FpG\&J #;!pKD 1C 1pG]&P&0Q#0Xh K) !ؑ D !P&KD 1C 1pGP& v} :OFG(F#* FC#%Y%0D%05-pC F-$!&oHO ZD " F` V+хB p$! F<FHS+]pGIFHS+]pGi-C@n OpOFP dFIFF@o#@q GEFyKyIzHGEF wKwI@F/F_)F& +h+;+/0x8 N+)F) O3+`+h+AfO;x+eM+x+И0+bI F_f Fbh_ICF"F0F0]I;F*F\Kh.+h!YO@m ZSB'uSAJF7O3^QH9!F( + JJ)F F7۹GHQ DJEK)FDIF FF0F_@ ;J4KhJF!OpO3+`/H)F' K+h+0O;x+?d/M+x+?_0+?ZI F_ Fb(K"FI0F#I+F:F (AF2FI |I"F w FF0F_-ɣzأ&&3D&E &&2&&*jM iFH!hF IjF , M]MM iFH!hF IjF  M]Z7p%0% + "T H $=` |HD<IT  0 HrK|+H"|+K`HK`HK`HK`HK`H K`P&x&&|&T&&& F!F %K@hA4&#-P!}  V "3 ! "[H!FعpCOVH"dxRI"SHSISH" }OOOr !!"F`@A"@AiC"``(ۅB?K@'!?J?H `>I F`h"Mh)i W9K"pO3 !F#` h(@())I-H_2(+Kh+!n M&H@"%2`B] t#!Sl 1@33O3fCF sm 1F(FL(F3ht!q &O&&,&Й&B7G1^&&&A-OFdðFF0qF0IH.h0FoF0F?#FDJ!`!Fv0F۹6;Jh3` /*F!!F F"0F"$(hGF( FC+JSh3S`XFkh+%I *#ICF !F0F0F"\Jh3`I %!F{I 0;Kh#I FjhKD !B !/Ji3a&& &0P&&7FCh F+ + HeJ#)F F#40JI2+ F6@-Oװ@FH#KhHPLPJ&O1FD  Sh/+}!`N $ |#0/{(F"h)@B@  |*N-AЍI a( Op I SI OI $J1@ۀM-@ـ~I < }H1FzH0 0BBtHwsH8rI oIqH6`hP;D 1+1&2o3h+L  1+Fchh0k)F0F(7>c``1XK!XOh; 6t?1h#a DOI"hIF #;`d #** 9KCD !B !ci3ca6,*$`i7FFFOi71+8F\@FU%IFF0FZ28F\2F!I FZ*0F\J)F FSF F\(F.IZVVCL\~,I" F8 IZ@(IZ:(V(Fz}D&ΚpmOc FF!-\CF2F)F0 nh FPh` mp FF PpF F&A I"F(FXB qC ha`!p ` h! p|d FIzd@ M%OcF)FF-CF*FF;F0F F F-` M FIedAh D#@ i*ъlce pG* dlfl mepGj bpGl mepGpFĕPlp" pO3 0pGo 0pGpLk, ыk+#p+##, ыk+$#+Ѵ23"+БBK+ U#`.МBт##"M#X7p+ F!j +Ah#hhhkGb0#h hh[kGbhlbbkZeke$*!аP#N!B٩)V!XB)тB3 !F1") p!!!"Oq" X7Kk+ ыk+#pG+ ##+ + г ++#3###jF Fh *!ac#hchhkGb0#h hh[kGbhlbbkZeke  :*K"acX7# 00pGhp!-OFh!FF&Op hhBؠh!#h`hc`"KhOh1FlGch$#B$Сh ZEPEъl2  kѾJmE jBp"8F~c6p73&-OFNk FO YE ܵ0+ۙBݪiRbԽiO  h)Q.AQ+IB +IB*IBв *E  &JBjh+ѫi;DhCE!p ih;D"kQZ"ZJB0Fa(Ѣlm#e#hhaihhnG(hJERE IBѼ3JBѻ  Q  )0  ] + h-OjFNFF3h 0`p#h^D3k/ճk3,ѓKh#n\hniB8$FOpFIJFCF@0F-ji(hI 0B C#S1/chBұkK hhlG(*hvKPBѪi 0ѡhYD k@CS  gK h#:F,#:F HFQF" FCF ~ :F  OA 9a p2 hF[Dm +tqh+m$03Opx0 qp0 @BFx;Fh[DkOpBFx;F h#0hmFKho3BFYDkDdFkG8F)K B,ٝpI x)  ##Ii-?#d(F3 4  p iIBxL-#F  ' I #-dK&&&"&:-CFLFF0+@@OVO 0BOpF0B@80BOp*t0BOpf0BG Z0BH L0BI @0BJ 20B@$0BOp0B@0B+hhhZjBE&030iS,/kk+qh]IB#\IB \IB[IB[K ZIiCj X0B/[/Y5D () Opd0 DI)@@\>Kh>Kh#80 8Ii-(3Kh2Kh#"0+Kh1(KGh#0h$IBѫjpi @   I#F:F0F-IB ѫlpim@IB&ѫlpim@& ] + )0 &\b0&&k   _IB ѫlm0 [Ii[IBѫln0WIB-ѫl[ns@i`@QI2F#F(FOJ!*Op!GIF0 i-p(F!B *K0 >Ii-`ll;Ii-Xll8Ii-Pll_5Ii-Hll2Ii-@ll/Ii-8ll,Ii-0llZ)Ii-(ll%IiC1#JBѫl30h P!+FS+hhd:FiiG+h "WChhjY F y  b¨Q -C 'PŰh F hoChhj;D[h3;+ En*FIiGOd*FIiG#h"O1hhj#hY#hai*Fhho3FGh"0Űh F!F0GO1#OpC#"](h!Fh0G E0𵋰Fl$"(F1# S"#FO1=Kh#F)F+Zpl4'x'I F#+vlm# e 20 R, F FF// /#+vl"!F0lmC"!Fo p F&Kl J !(F"O1 #OpS3F(F`l`dXf0Fp-C% F! F(nOp8N%` `@a a@#b b$-!+#Y#/+Q`7 5!Op #Q F3"+@O$-D `K@!JHh#"2 !JM 3"2#%"1#!FkAFX(F F   ˨7֨ X7Kk-C+Fc+++г +[! @F(W.O`FW !c5(aE ˅OpG `@B a@= bOp8K"!F0#M 2J3"2# "#1F(FK F |k+1F 7I 9 } -O F h%`h+Fp&(B-πh!O lNO  (#3!8Fj#h!h, !@Fj-@P"F0F<#hhh0P"F0F#h9h#hhFXhF@@+FJF!xA @ B ?L ! P "h#"(h"#"h0G?F/(h"QF"hlGO8 6dFė#$" % G ;B2G # F9F0g  SS D@ D8S(D D()hS D< D D2 O@F q $i-AF F+bhhmG+hih W?Si+OzBzABN(;khp!h 9`+h1`i h .wF (D1F@q  E0#sK`ca3c# FA R :31D^c;(ѽc -Oϰ FF"!(P(ph/! WET0+ + # #3WEO3 Rj GFHKh O#F@ =P heFžžŞ @T0+ + <žŞ pWEO# 0*F~HYj#B%FWE80HFlG(B@F S`32 05HF0 0 lGF h FO1h ##" 0IFG(F #!###"#hFhkG"eOp "JF$ X @żŜO % #S=KAFF ;K7#<## RF@@F XFL+h"WE h 8Xc";m#;e h*Fh0G"ckH(h hhlG"hbZe Fed!F0Fhp+FG(BCc RC#&  8`888Z+WEh ghp3D  i RDDs;sch;c`O0x$JFrWE?p3m h :Fh0G _h 3_kB@5  #i@#p2h[B2p"ch[(DZC)DP i RDDDs F;s#hh[ ch;c`!F0FmP% B5-A FIhp&Fha  +h`hkhp `D hp"!@Di1  F(x 0DDAFPK FH 0ca3bckh3k`#$)F F F)F O0  -OFӰFFF±?5YF" "< :_< :O<:):: `!" &O E$#2F'(#@F DDG)F0F FS*[F J! wOK 68FTK"D|$,D<8F #F aORO3Oq#-A F aklO@Zkeh9FBu9FOOzsCCBu#XCBuOS FA@ZOCOC@Ch-OF+@ A"hAF Fl GrW AF Y I hBh:E"h Fl G(r#Rmi kKB{ ۾B{  EBVByP+L#(FIF"h #FF8FQF0 FF  XP!J~'h#0FYF:F:F#F FFF JP!vT,\ ,!> \1yOy&r0&-OFh FFhmG+hh F*M O h!DD@FmFb(qFH#B4рH"P X.2S1"`",3@`tJ 3C,@uC,"#,pJC,[# mK@lqmJmHF3B @qa"ZgJ 3C,@a"ZcJ 3C,$E#CO|_KBF_H^KJ#,.IB:OQ!1B5+IBє *#ۨXX $$ #+`,"H!IFF F(c]b/+FKB KBEEL#3`EEZ #+`#3` L LH&:&ĩK&&T8 T& 8T&(9-OFFFx+O0F "]FF#;p"+xc+8M+.C+2G+++/#;pkx+ FQFS+* !m+s+g+*BFKFO@!5"*BFKFO*YF-OMhF! #m25(FJ (#h FlG &h  Kh#BsF F F# *F0Gh+޲`Ҳ F@ FJ!^-@ a6J_+D!۲ [FLOpO E@KR h!hF>S ! F=T !FU !F.N-C<SlI3F:F8F0F(F@F`K%h5 + s+FYK h#BZJ!-&*x*"SI*FN#O1& "F#B)Fz(9kx+@)x`)@ B#h0a9 F*FlG(062!F"###h F0GWk;CFF3 DCv@F1FfEv jBAFVF2CCEFA߀8 Ja#I\* a6J!_[FD( I\#F &ͩש0&ݩҩeI cKh#xF F_I16ZKG0h#dF F&UISKVh#VF F8FOI&7KK!hObFhN0h0I*F0h2O;h; I*F{8h& F9 jF!qIFFH0h I"F FT `$`&8&#g FF"FI@F *F(!F F@} Fp"FhF. Fh"F@&I@jF }80} FFQ"FhF(FI"F@!hF,0DI@jF }0 A F,!F@/-AFFFFF0F)Fr0~ ICF:F tF0 F(FK$D"` %MH&8 M4htIF FPF(D8H&d-CFNOD%(F 9FHF\FF$h IKFF(F F(#h F$B04SH&tFMF4@{4!  4"9FF@;N"1FH DH&pL4S#4T- TTp.FV;42 I3FF (F )F(Q; 4:(FH&tpFF FH)FJF Fp@8FF9!FF)I*FF @ 8FO@FO@FO @ۿK8 pGH&0%*F!HU!UFF H I Fx I F@ @K` F0@~ P9Ȫ\& z @-A(N0h(q/HO$A\#F"!F?F 0h0Q##"#GF(3h$(rRQBrR#h i F(( 3h$h0G0h$q T&h#p$B Op !b Bh"Rm*3  pGsj$ Fp6h#hFXh+F2F!Op#h F0GF(@!F + pG KFб&M$&K!F&J/h$H,`#H I"F H Kh,/`$ F<K!FJ0F,!KJ0FKJd!/` F(I FA@1F &ܪ\& &)7 pGHk@Hf^ pG pG pG8F#Q۹ҹOpN F8@suy (3B## 8KP0hFhM    Op-jFOOO# # F( 0Op\& pG pGFF F&Bcm+#~۱I騹 Kh$1heOp#Bc`# #e `Op6p4\&pPFF Z# M> K(`" F(`p3C# @D4C $ ! 0&&F IFF~X1F("H:F(F!F@ſ`&1H[ % p"!hFlF#jF!@c0Op N K!3`F 2hkF]I I"F  @pI &h0-GFQ#0} Fh(F0T# (O@9a;Hr:IF(FB2F!8FF 4I8F (F)FFFPFF( 0=+8F)J;F!8DLX$0F#Nd"HBF)F0h ICF*F.0hOsH"FhI"FF[ 1F0F }0h0I0hd IH稡$P&ѫʫثr`F0 FQ#0h0U# N@9 Oa8h0 I2F8h*2F I H\)F F2 NOs&)AKpF F2#K#FhF2F,ж0@;U#0(Ѷ0OrU#0 a Opq(Ѷ0 OrU#0apHT K"` D&-CðF F"!0F, oFO99F iN{h+ ѵ0OrT#0 aC5+I JAFHYJI (JIHI 3x#I2F ~!@M0@;T#0r && &Op8F F[0J T#0ha8&R!0pFihiF0F#FIF(Fp@8F F~ XI $0T#0 Ora 8Or*8 F0F Q#10I T#0i00OrT#0a 89 B@@@I*-GOr-F!D,ve(rjK`@5!( Fr(b`0h8]J1F 3hc]YJ1FF  ,8TJAF SK PFNIRFFHF"HFFHFOs@=d'FAJKFAF h @9#aOs8L%8N'F---[4Kh{b54-1JP1I 1H *L&ch++ h65GKE<4($K%Lh;V"F h= h* h;J#@K2JF&!JF"!o2F F F:&UK& N && & &&u'u'? > -AF1HFk0I.NF(94h<@F]+IF FX%HUF&H(4 K#J HD0h8*FI<0h"I(FF(F@ /F HH<I*F F FJF &(ۮr`FxѮ!!npG pG-O%,F FB ``.=-;1 DBt  C Ey Ew # C Ey t7BBt h.6`g Gg@@51Kh"0pG&-OFF Ey #MF FTFF*#gs#"#.w2F;F F)FCsG2E;F F2F)FeBu4F=F2IO Bu EHF0! @ 0 F ObsE5BA   E  K<K<3BE.FwsG2E;F F2F)F eBu4F=F\М *X *T S #@ BBGBzBیBu3Bu 9#Bs TJ.wsG2E;F F2F)FeBu=F4FBul#3 eEBr   a0%##"#U#( (F)F 0rpGFBh I F@pFF/!0F~FH0FFȹjx`*ٴa:BaBp034O0"H0Z * F("HF 0FM+h'(`r#BA#-hhB##" F  ^h B 4#+a\)3B 0 &#`FFFBܔK#`ppB,+$Op ` !tb!PBBt %`E%1h;` 532 8OrPF!0X #P`08$ N MV; F!,]#",E ;X9&Kh H&&-CFF FE0F*$+F"Fpp'B2B43LE۸@a4 ؼkh J   Fih JkhJJUF0K@QJH@h F@_:k8FKh _J#Bز83 2"+ K"h KhB (4Bx2F&&&-CFFF0'0' jX3iA" @pBк+i #t#i&D BKOYqJHBEt +j 3 h3BӞB  2&:k8F Lh !- #@8K"=hB7K h4#<(0&&&KFh (@ K&X9-AF/LFh !- #*N1hFBї  #@"FR4eE(3FY(2h4#P!OSC22`J& F   P+F0F@s N J!F8F#' 6'c&&&F:KFFh m&*F3FB [([лBSP#F"7C C C !_#sC`a!s+Da. a!bb0cbX3bѕ0#iC#atBB/D0#iC #a h3BӟB62&F! " FxC$Op ` !m-OFDM3sKOqsJsHPm#rK@nJn#oKOqkJCn#mK@gJn#jKOqdJH ")F@F0bI@FZ808^N <F/ Baє80YI"Y 7'FF? BY&pQIFPI$F(I (Fz@ DM7hQ7I+:+ #;0a+I(F[#0#0#0C0 ++ ї(F0#KCI10(F7;B̿II$.:k)A\vo ,EŰܰ:/ȓX9 h-OFF Kh " h  hKi i    ###P+@O`O62eYB By"ۻлr#;C0 I XFIFi ijFFFMF F FCE s F BA (F2FJ KEuڸ e >M+h# ' (`0& 5FB 6I hB[+@{)\6 h-D5-<)( O1jxj D"[xK@ p"5D%0h3`2KEr ۳ b 20F-)-ѷYFB#1#F&8FM+h'(`# IBs IBs ڣh"#r#8Ob@"&@8-OOfq-FF$M PTF%Oc)Ft (0CF F $M^I0( F~0FO1QEFu RF F\Fy!`  \X4%F'F+O+  e``` Fo0CE&0F>IP (qд *)#XPBB+Y37B܏0 *?h2`+:+>+,1+01#1#0F# :Fx"HF 0HFBFs C( 2Br ڄ5  #[b2 F<edAE-OFVF; Ofq !F({OX"t 3+ #O0! FF 3+#O0!FPFcf#fSCfK#`tVcaV`` F IH"bYv#0 F9sh3`#0H:vFmFFF+Kg!JHmKh!JnKi!JCnKj!JnKk! J}CLaOȿO 0;k)A\-OFFD0F#Kh OciKh 1AXKah#(iiibh hi)ѩi!hh(&b0&&k-OFh}FhB IK "II( }3h0F:FlG(;i I{ih+E=L 03Opx 0 +p#kp#1h mIF0FG3K$h#F#F%FFFZSF h ZFO &I(F"(O2)=CF@I$h 8\+hd @ O XhQ 0hMFphI&J#! @Fd4O@B#!HFd(ȡ 1FOp  2s rH0$1hh0$1hXh PO #C +h " $ & ( * 0+I"YHOq`!Y`@aUHYaUHh(Y22RI b@b#@u3133o O3GF |CKb0Fv0F+++@&7F,(FG(##z05K" O4 F-+h9F(FlGp2C !#h;+67hB~@ %8Kh)H:(FF @+h0+!(FG\B\AT&z;ޱ&(&%[ y\ 08X X &X rX &6&+?!(F5hO#hh0Kh@!Cb@!$ 0F+OE&O$!(F(?(zaR hR4 Ch(FQ$4 YhB0F2d 24B"$$"T&-O+հFOs K !O2h FvF@! FpF@8FO PFU! Fa (@@FKhS+ + 0BW+Lі(1+`P`,AR#d `E"qSO ".JKCS!B Fd@FFOpAJFIO FxFH%*P}J` 5C0+0G(  pKh[E-؅$[BO6 @BbFHO MFF 6FOp(1D!O !TIHF ! Fd@od!>FXFFPF 0F #D 3D F YFFXXFO ! QFFX PF 1F  W0F F B+K@Q+J+H< F#"9F23*F33#O3@AF,FB6 O R#Eѹ F@F8F s?0FyBLF[ &&&iX t;ޱ-GmF FtH!/# 0oIOb F xx[gJOaF FO!O /! F|T8B!F8Bx/* F(ڽh(FOb1F FVoӼ?#&F0F9FdFpC O'ѸѼ>#`*@20F9Fz(;x/+ /9JOaF F4Ob9F FO0F6(*Ob1F8FoOa Fo*(#x/+;x fx&v  FF8F3CDDoFIOb FoOb9F Fvo}(FR( ڼjh(FLd`/(FD F mHOp! F( .  O F! "iF ( F ?@ B-GFFFwF(=иO&(FxHF0(Fv8Fc+ 4I" FF(I#FJF0H7%3FIPFO78-AJmH]"F@‚H(lH(g(@ۀHGObF((F($I( (@(F(хI(ObF `I( bIF z}I(ObF `yI( btIF doI(rIF [F(@oI(lIF(FNF(@iHObF ``I(]I bF(F5F(@RHObF `QI(!F `TIF(NIF(FF(kNHObPF `\GI(nFX; `EJOa c` `06I b;F 5 -$!@+N0F Jm(2($1I(;ObF ` `6FX)I()I b$F(F$HFObF( I( `JH5I(F F$J cI(?Dz.<Ҳ۲ P `pG# `pG# `pG# `pG# `pG0ii,!F@BdDKh#J!(FK,h6 7 !vP"FFHx F_ 0&0&@&-O@F# h 2C 2XbhC#k:գk3#%kd 2S+KjJO FF J!>c %h[8hkh0G8 %Op O3c{hBپh fk3 ! 0BO1c50@FlG(#EE1cmpCBCA_KO h#D\K]JFWJ!+@O3 SKh O FFMKO # -LK"O10 ##+ "Xr?KFFx*b >@X%*Ye(qO #;08hhlGFF2YC^Cf3I2.D FKFBFPF1Ff#kD##c;0+ʀP 2XchBA
BqFFO |O3 x3)O $&&0&o gK ;hdKh,!<1FF(N#*s##Y =+;TI@F(5.FBE:,p!BE قk2^!hBEѣh hb NB`2h[hB2k,D#;0.0-vp#2I 00j (h 3  k"cE#kC#cUEFNFP>#k 2XchP!cC#mBfF 28FPf`@O Op Y ?mHFQFmY ?fHFQFO &T&@-CFFjShBgp&h~C#0!k(q ےYdhjJAhhJ! hR\h[mM,?_JdD &!4 h4Dj+H@goWJ(!FO h3DkQ񔀛kZ=# # KI&:(F!# @AJ &!7KHF!Fh#9J#k ,5J(!"~b#m4 @,J#F  УnOp\h&J#F`kh[o3h3Dh3Dm\@J(!KF Fr@O !JFkkJИG(+#p@#n&̍q) F$eh#p&FFB9(G+Q+ F, P!&J#F $#H* !H- JF!hJF . vKJ!H)hkԉk?C2 ++ VP"F , ~ȓ0&;.&Bh!-A2Fjj5 ;NO FB=9HO@P"Z5"a3Ja@b2Jb1"c1Jc#hg2g hhCE$#OpE0 Fgj(ۡji j /k2p50L"BlhjFAFlGHFGkX IhgFF3w ;  -OF4FFFO p' E6ѹlp'q(a0IF:F30 Fi1 x#"kih hb####ice+je8@ii D hjB6* Ѩi@x1Hk1&#k h#`m!cH*Ъi*x"mB"eA!c##c  fK-Oh FF8F$k(th! XFF(ZI #[E$5FOsO H0t@uO5"AF@GKA#2ZF##@F0KEiqhj1 F(`qhOp b  h0(Psh` DAFJrh!F  @PZFIF FH  # #ccFf8Ff3hcc0F[ 0sh3s`,O03PY8F8F T&{ -GF FOp 0@W"O1+O / #30 /+ "9F/#0ehOEE?ij ^F(ahOphS(bhP`!bsaBFE O5F"h9FFBcc"b ""V^ch F3c`(Fh9F 0(xOp!@FN(F,{&P-OFF# FFC  %`  2Br ڶ iqI BB{ [b B p!``S`0KhOO(rImbhqӧh#Op B qj(Hm3&;  K'hhO333E򘁫j+@&O WFh+hRE l(FGp&E٠h0Dk3ўO2)w ,qB2I#+:*@!3+#h ˱E@p XC:k3;XQh3;PAQ`13A1{/ۻYE{(E@ PB<a L#p#GSCFPC`DP 1`E#Y FE@فp!ACxyX@hYB Fh"E@ҁ:E7!(q1p#hSD S 0 _C9i 8FIFNi B{ F}Ik C p Z`chB7C;B7APQ#G"FPC2 DBBq򆁫Brڧh YQBhFF {W Y0yhAE{ :kG@E{? T&&>bhB>B@`p" a +FHDI0A`q )s!#IC`##;k#;ckCc##p#hO3BDjUccPQmA+hmkGhhCDb!hhjCDBZm**kB cj+HhXvhAPQCQ`h , *chB:F7* tIFȱrIFH S)r T R"T "X *7jhBh 9FlG(h+++# 9Fj#Fd'l QF(FGh+ 2Br  [ BB{ #FQF(F<  g#E803Y02CP АBA歺Q0GE-p p"BBлk3 0S9khF2p7F FzPB4 a D#xp"ITC"FLDFhCDI``I@-O%-FLhF(Fp& #B#-u(Dp!+F(npFO p70E"ӤDPԧK$\CBTХK@]QJH03nJk՛k35Sh0pBp" FBnc#k)գk3&ѧpO p4 p" F*n.lhS8IhhlG0##W<[hEp4  p7K`0! @wKh;OX&hlG BBO3 H$F0BpBG5p'e[e+X u T B2E # F)FzeJ 2+r JBrv[H0br` %Op 0By (`+ sO3 3.@ O 0E1 'Opp#sCk?0F6 XkJ[:FL(XFhlG0DkX2jFF-z ;B2]J #(FQFj -H ,F607?H0m۶C>s& pGD;kYkL(`^F3#B 3h0Fo#G0 S 0BABB #0F3h"Fk#G504L3h0FlG FFA#0BJp"0k3t+kqjhY+rj 1h b0F2"0G(R##ihY#BqF F#3hjkGa"km!Fam#bmcb+nbknb3h0`a0FGCF#3hF"F0FlG+kcC +c#WG3J2GSFBF(F9F g 043t2[ BB sp#p k3@#k@𬀞@񭀣n+lZhEhS8Ihhl"G(S8 hh"G( h   bhX b2"0G(9,FĖ##)F"h0GFHH*FhlG#d D ;B2D #0F!Fj d ' hRB   o" dhDXB2"0G(  05bhX+r h     b2"0G(:##ahX#BqF F#0jhkGacmam+bmkb#nbcnbcmha+?]j+?Y#mC"e"~*?QC#eLo h    [B3 fhDXC#"0G(wk3=#k9щXbh)r3  +/hhBkjGacmam+bmkb#nbcnbhah0+")FGBFu7050B#p!O0 B$Op 0B p%@2h[b2#CE@p!0F%F08"O0'hp3B'Op E@,F' GE$p'0Bрe;l1F.G6i.BB0BB*F1FhlG0cccm+?|j+?x#mC"e"~*?pC#ek`)FFGb "3ch0.!FXFlG(2!`.| Bk5Q)Qhq EwEicd4@300XHhCЊk263F2Cp C`|O kCKkB k  +hB Pp"7JYb٠j("c:JYcz#@u3 <@33o O3CF ,Kb8F8F/?++hTjV##0h0G?/ƀ8x@s~𵍰 _W7FF&+l$jFinhlGH2F[B285B&` h #*s|+ pG pG-GFhF-FFh<"Pahc+hhc"`hhJCZa+hi hY)`C PP'J`P'O< hhBܽ61Chhh{C3\ B^0+*h0 b chc2h n{C3hD0 +`#i+*F1F@F`79 J0hB*#pG& K`pG&8F$0x1h0G F8@x1S%5$hB%-CMP >g ^3O20`#DFF$O<RqOA L 5@ a382+- ` O@uOC4O @- 2D+F*F#3O3?FO0 M87@F:hB S (IF F@? im%IF#n+#J!riOp@A icnFn+J!^i@B n+J!Ri@C #o+ J!FiOp@E icoF ״pFOpFF"FhF.2%3?KD`T 4#0Vh@ idB 1K1301! J(F,h@ idB&&>-O#-FFװ  0!J03`NO4hF#RF#hYF(F3`j#Kh[#NRF3hYF(F#`[Pi@0A P3L`OtA PK`Kh+3W&&& |&>>&x&? y &&PhKO2-Oǰ`FeKF%hTWF(9aKhȱaI"|1#$ |Ah0G`VKhWI"~O8@FG$hi*O2O3G(h0G(GKh+iFN%F0h(D2h CI*DkSkhjkkh4H5,I2Kh(6I"F1h)D l+$(hO oIlF#G1h)D l$h"  o#IlG3hI +DhjLD3h+Dl!2!кQFXFKh@K"`_&&&Է|&L& vD$1pF FF phBx1;!Fx(S%W0FxALD%8 PJ C $1I 0# K #3K K ]i  &] E h J+ IO2 K JK]& ] i E 00X>J`k;+إhݱ1{"h3BOp *(^#10K`0Kh0I* k#:*  ,0=!F  0!F $J $I2h2"K#J#K$"J "I2h2 K J K F{J I2h2KJKK JIcih#KKo&T&& &  &y ՞ ټ &)  ,& U 𵭰FP"!d##`TKhSTI " RIy h0:]hűhBD"; hP!D 3kjIJD" F -H0H3AKh+9@I "F(1=Ny3h0:YhhB D";'1h)D41$#h7'7P#o8G3h.J+DP! 3usoѸ&Kh+6"%I쀻#MF!z+h09^hhB#`!+hDeFmX`1,2BP!J[j""0bcO}O0{|&>L&&V&x&rT(&-AF$AF,)'VrTF$:-OOR-FN!PL] `l+ЊO\;h+@OL;hCOq !8`O4;h+@({O0+@xK"O O`O1XaO|a `mK  1Ox a`fK`H X`1acIXa`;hJw 3Ha`PYI`S03ap0"`d a*FF'D@sEK1FR"DKDKK#2#OpAF1`h(8 @B ]Oa p(@8`=H! e(L8`IJq Y8`(KG`!f2@ a0F40Fh+Kh$1+Kh+Г|!jOp (!F`1HP &x&&|&& &&&&,& դ e T&&(&&L&&FtKh3"FI@P <&QF p$a3F2F1FPF(fR##"# G(K$hR@BrR T&k+K@mQJHh(?e-GF F%@V)@U*Eܽi+XKE ѣk+ѣhh{#{5SEѣk+ѣh|1 F$1{CpFPM    Fȱk$Q!d2>$hikO2 FFXJ#|1`p((F(Fh)FhF_"iF FhiFhF*FhFe(&-AF-PR$(*,.0F8O60F2($A#h F0G#hi" F"#GF@#h F0G$a4F#h FlGP     FFVXK "hCD8"G(P"!hgc F 3"c0G(# F # ##"#h0GBF#h F'>FO8lG!1h!F$$"(F$QhB/WFFE.K@Q-J.H>#hk+G#h 1F FlG`BѸ?F76#h 9F FlGB BBѶ?>F7hBs!21 O2F(F+ J#|1`'O6>6?e&-O}FFFFJFcF(hI2F c(  eI@F&ZF`F(F(F_I*F@F0Ѷh+ZHIFO0 }k6j`j`+k#akkcakakka@0#bB0cbklbO/}GI:F@F0vBI*F@F0;AIJF c@IMnQF8"F F@"F;I0FFX9I0FF 7I0FF5I0FF3I0FFh"F1I0FB,?F/I00FF"!8F1FHF0' 0B BOЪ# (5D*#*#08 "F ]( ##d@edA#zd@v$#$[$$+$?$R$g$-CDM$OcFF!FF CFO4 F DM"FF;FHFF(F ,0 12O`pG-OFFE ,# uT:E; C "FPF+FYF k E{RF[F"F+FkBs7\bEsbFFx!Oii@1l a!ZEs B +k#1kEA@ F a9Ex#71 H C,ubF8"FE9 C +F@FIF:i EyBFKF"F+F J EEIBADrEs 6Bs:EAZA,u8E9C "F@F+FIFi EyBFKF"F+FZEsiO Fj EzFFؐe0%##"#U#( (F)F 0k#pGB3D0 D0pG0pG0%k#F B05hEjB %jjCX@Bl"d 0#lB C##d@, pG& L<'B##`36hhh&pF0K@aJHk=`h Fp@0[`h_`(F5F眹H?FBh IS F@ܹpFk%O5(FpD1Fl( 1Ff(@5CFVK@JHiF H! F(K`8FNX0+V #8#c3#dff# c`VD0`` FQ?`?8 FkF# B@3hXjB jBCXD`"  8-OF1LFFcB[[EF# 9B3hXjB jBCXG"hF9FhFiFD1*F FD @B1*F hh*F-#p@B l   *FFFh-A'F:FJ EkkEkBLktڸ \k ekBuF70@r;0 h EkkEkB\kt0*`p -G FFFFĕeF#0 0F ##"###1P%@(`O0hkB-@{ ! EtFFF -K+`00*FC!F0 H ;i h3`2[b 20C03k+УB " 0 F)犻-AFkFF#FB#+i-A; BBM! pFй*Kh;` @3B0#0!"!F04:F#AF0#(0C02[b!a F!)F2 BBL0&pFhV#kFB ОB % K` p(F3P-0й#c04#)Fv(h;`2[B 20(FjѻFh  " FF(-OFd]RF ЋK@JHKh#KOqJ P IF(@ȀKh} J)F R(@H! F(|IP 4DuI P(MFNFF'`p mIعV +ChI(Is J <0k@08Px+П,;F F "!P(FCF,$/ "!PF7/ "!P (ѝ`0FI"b"^BI8 j=I0s J y +?v6I "V︱! Fw + sXXFn d] kD0`"9FxcPcE0 j[[  :(EP#C0@ 03 0)@yB&#,&>ȓP^PlPNPB5$ 0 !X0  0 0$050#D0Oc0WFF׹0sxs+4sxl+)O& "8F&K(D" F3*FYi0=0<0;0:0 2K'F " h J# F#*Fi B73/ѭ67.ѿBR-G 2 FFx۹P#E "`, . #r 10cr20 00 7(I*F 6 5  3 1  . e ( ѝ0 00***PONF9Fp퀹#c˅ #`,0.0〝00  O0SBpFL&{@!J 6 {c{#{zzcz#z#hl 4G. pBR-OF0z8CEx'O`.{("ЦVBVADD EjcEa`DBa~FFEB,S `` &.(J{O O `~ .gD afDBмдE(FcEDcE 6FE CCF dE(dF  O0 dE(dF.7/zy y pG;hhB4O0 pGO0pG2-A4;OB22rF`F$1CrE,-%+#h3`1-+rEO1QA\B|  47,"*ѽlV(؃( C +ER@   pG8(4  pG(  pG pG pG pG-G$xFF#F ʱB 4uD$G4-*8""3+ y%.= оСB v#D+F45-"(r` pGFJ y)+0@ pG pGJ# 2J]q Lvy,4фx?@uF82 Bт+h1F8acaq4FB!Fع22N+h43B(2+ѐ;F4i+?dJ``Ff-O,m FO!!FOc$O4 F ,mkI 0s@"!\2 Or!Fc2K13]K@!\J]Hn v"hZ1psppqsqq26*JU#&2*F ^O[#0FYF W *F8FkMh(zB,8F~T6+P6+PFP&@;SCFFFE(FO )? pp1?A pPDF8FFE(FO )? 1pq?A q(FF0F*F8FMFEBh Or0D<*F1F8FMF0FsOsE]EO4d@GG FR5K@ AJH)FFFjCK@AJ Bq#`4+F@ @0筽QG FFi$MB4D5O4Whh G/ܴ Jh` qi ``B xc p`&&-OFFFFFΟŖ40PI "B%2D1"uF u]eEy2.-8R-R1)K;`'8F")*!&~ F2FO   мFNEF62*- ؍B /@8`FRn*F@ #0FQFjBp3F +F~&O  >  мJE26.R F  B}!)*8"O*2 O (F  2Ɓ" "B<Fi0t/?K4KGO qO  9 $)"ВDƑD N E~ ΀ A Ey €  "OOQ\  ) K@Ta JH!Bpp/?Op`&ȽcG FD SE s(;3q;F)DKF(?12k @BZR # E# 6E&0 B1E Kp"! F2EO3"\( )2*K@laJq#D !I DBEOr ڨ/?Q@L sG-OF FFFĖi#0ji2K@JH(K$B/4D3O4#O7F s \)/F2* 4k+$+,'Ѻ @,ѺvK0O0()[D41A! +Esz C EAkh h  C CE 2Aں@8B 4< F2Q!D#RCB JEA Es!#Oq F(~Ѻ+0P!*JP# FyxCF+"KO2h#RZEs FF"FQFXF\*FXkCEE@30BFFF@13h0F`!"d!*Fp#FGP@T&-GFKFFFO2h#R0ABs FFo4!*81?+ Cb#@3"BF?#F<` 03h@c#BEs ҕN&M+h[3 ћI  +hCM+^F( 0 IXFMRKh+J 1!lEJ7+wH@FIF`w A F9F( `ZJA1 q ! {z'wd/d';F@wKhrK*"-:Dh *WCoKoI qsSkJ[ jJDiH#BFIFFBw +@+aO! #q^J0!Dha 8t#as:> `>KA0 (q8 ]۵ `A0 Q0 f z/CSO"qӺD 26Jd!q `'KD(qgJgz;+{۵@Eq I#JM {! % 3BR ` F  FFY@.AB'B'pB'B'xB'# 5hB'5`B'adB'Q 6Ghdrddd.r5JQF8F4D+q`0J*D/K*F!FhC*N&a`A FYF`#KA0 ! p {E?uOaa@FFJQF8FFOaa@Fy Fp+DP#oL1;L1+DP#dT1;T1+DP#Yd1;d1(F,52;2b.Bb(F,5 p2;p2pb.l.lb7F# FFFF(AH1F! FD1<1@3S,B@C,8! FBS,B2C,8!)FBS,BBC,0+3D&0` HF(F5FIF(F/AFBijp+% p032dUs+CC+C M` O(8  pNesBC% px1hs4˹k RC F &v%UsBCdh F F ! ! 81CC8181sZF(%x1hu F%(/K.Hmp@ʽ(Fo%( 'K 'Hmp@mh<1V H!p@#FJ!81E.C!C+C F,M", l0 H,O3,1p(Iee f5 I8FHN2x1h5!8@+j+I(FqmhC F818@]#feCoF FsOrQ@!]0 Hq#0  h+F9F`F@H*F9FO0𽥱@")FxH*F9F% h`% xP h2F9FH1D1! F,I-f?f-OFF vF`X! F 2"bFF SFIF h0 F329C2C2U0#EB HIF I F E#j+0329C2C2Wff7FhFEQ0-AF7U< 8,H AU#a CБ&FV !F( #!@F1FFHl#hx1h0(#j+% F  FA ٺB+js33S<0"AFxmhH 1Fsfff-AF FFF F^d$F F{(Z#j+/0 3` FA)FBH F h1FG>I FA;H)F:I F9I F n030+[cj"! F FI0Ѱ(h++H-C"A! FA.9#j+ "HP0۱foQhF)F2F FboBiF(F@#j3 FI F #j"# FI F FA HffgefJge5gFQ ;Fxbjl0 F@'lp+hF=03P=Cj4"!o81 033S<ݱcj030; F0 HQ"A! FJ0HG Fp@w%F#JF F@-OF-hFFO 8ĻEV(HFx(UE*#j+/W0 FI322F)F F033S<BFKF F Fe FEdh F E F 2F)F F'Jg-A FN6ZG!(FW(,"L0>I>H(< ((>(D9H)F(S(5J6I6Hb@03H2JO1I.HQ0M+x+#+p81:F3F F/AF\#+p#JF%IH4#JF#I'H,!J"IH& FD!\1)FH1x JI Hx"v"!O0g(mF;H`!FFO4#`8h(U8FiF0F xIFFj# )Hcjkb> > ***b jF9F0F+j(F$2{`h`#c`x1Zh``"Z`#j%Fz`IFH F"#( FS2+`h`z`Phgh\Jphh "F+FAOq0JIKH#+`)h%HHOb5OzqF(F*F@H)F7Ѱh7+аh +7H)FW# FtF(.H  x1h%oh 50F)F(*FO1 F=F2[`h x`FK"! 5h-0Fxx Fx Fr`x1h`Zh``*Z`+j+"#(FhK:FsJhhh : : ) FFIH4 F0ѰLh7+ F@2Bh +а>hV+ а8h+н@HJ6e-AFFFFFFp- ٰ7#&I `%HA%"B#j+ H ;F'>Em**F1F0#jñ<#AF* 9FFH)F<#0F9FF H>PF**F1FAȼJ$i0iMi-OFhFIFF F8I"HF O㼨I FH00A F!FBI FF(𰀞I F(e0C0 W&46DFE F F(ۀFO EI$1FHF LF0FN 4`9F@FKJLAEO6h81FCC81#x1] "(@x1p81#C81$&W+  FN"F<PFvDO  ;k( N(4(6($U(JJp( x( n(K J JZCS#$FF 0 3FSE۲E W#XF3("FAF  B$D{ 0; 3FEܲE }W#XF3("FAFHF081#C81O00կ#`  SCjаE T(FRF!F>x1? : FEjiti{iiii` KiW)(F~  (P5RJ 1C P,B, !XFw!XFBI LȐ0ExW&x/j |6Eu(F;FxBFYFie8F> F*F[# [c KDc`> F*> FD8p1pFFcHJF(p1tAt&p?J!?H h+8I9Hp (6Hg$p>02H M3hx1hll1+,HA"1FF>0 dh%H 0&Fl11F+""p#FF(C  "!,jDF IOr(FB0I H l1+?|Vqjq5KqqqqKh*hQ`X`pGB'hpG-CF FFF0&K@G%J&H#KOq JK@#Bѯ#`O0hh 2Z`bh`+h#`\`h,`3e``#` #aU0hB$h*a F(l`r KrLr0K@JHFKѯ#`O0h#hBhO2`hD`#U0FrKrFFF.`''`okg`<`lc4Fbr@Kr0KO$qJH#eT0rWKr0K@!JH#T0rbKr pG pG0K@1JHdCd rnKrPFFC 'K@# 0%K@Y1%J%H~'$DDkB 2FiF Z0O0 kS$0;>+ٯ#`4Z R( CB(<$DDkB k"S$n04UG rKrX! KFH 0 F $ F"F#4B ?"a"FB(?b"FB0?#bc#es,7%h*h.hSHhЈBA5FBkhjS`kh`C4h;`(F c`l #UU0hXj k#V0p@pG2+Z`Bh` p"a2+Z`Bh` eb2+Z`Bh` ZbcO1F F@ L-CFFhN'T0۹3h;3`Xh#l+alG^K@A^J^H|jh+ my Fh+h*A2cZ`jh`0G#+`ckk``ecb.#oB#KFmFU0Vp+8lKEҠl"IF_h l"h2hh?PhiH`Ph` i`P``"a F7h``a3C #|HB#,U CF*FhlI@CF+5ohh+?ibh@B?\cmW00˱XHBHBrHAqAa0G)=-?4B'rKrF HFzIF Bc4 FFg -CF#O MFF43OaCF2FHAF iF^F F M4((@- ICFH2FF4BF1F(F $P g R]pGM FFF3F*FOahhF8F IjFF F` M$R]pG R]pG R`]pG R]pG RD]pG R]pG R(]pG Ru]pG R ]pGKpGP K0 PEV#O5`(F-ٮ7#"F"b;F"=2ѝ0>#C0<#o F H4>  FF(є> *rh F dhhpGh F 3dh#DFB +:*#+ ,F$p FF^#/x+F" F( "1F(F(:!(FF(\oB0# !# "^c;,`O0p3p")F!Kh.F;#Z1 R4#oB# "0F2# c3px.+i+#oB0#! "`cO3cc O3c:+}o 0 FF1$hd#`(Fe0$E ( F0i+dh-AhF FOh۱ah(FhSx+ai2 ich01i *F0F! $hh(#` iB@hx1hpGCj@hF"!hF "hF hI#jFC$~i-OٰF F#!Or OC {F8H'8FY#0 Ft0іH8F s 0[x+gF(_ 0D81%JB(F0"HQF++ѹHQFS$$ # #(FI(d(FizsdD(F0#P0lcd,b(Fd#k`{h`d`5}`@Gsr-AFF - i#\x!hD|#` FRzh* - -*FhF( "l052i%BD!DB,D#iBdh߿04 5!F1Q% 3B۲ 5D#0 1A%Q#"bA#^#3"bA# "B####2#*0FF FJF(H(FI0:F H F 1h"(F1^HH F ,8F )3hFZ2`@#pKpF FF x+#;`+` /!FVF! " F# # ";H!FO0 %)F T(9F0FsH1F/#<-8h a(`Ssds-GFFFFF3x"+ <"+@Ѐ?6@΀0x #; #0B%ӹ0E ##p1F AF(hѮJ7#`O0 (FEE1F F* E,2F;\+@sxx+m+0+[b+ +{ n *Q"] S] S] S] ] S] ] S] S] S] ] #;PF.F, #, #, ##0(KhxY2 Ս0xY2 J050!," 6#0+FxF30 سBF0{"!,( ;FF?4 6o XFxF2 + +pG+FpGPx; + +pG?FpG-OFFF(BHO==!FP=IBF=HA(FO $pg(FFF[{Ϲ(F @FF(С"HF^T@$P#c``=!8FB:F)F8FDs@FdFH8F `@8F6@F0F<F8F -( #U4JF1F D0CDZp4LFK{spFh% *i#jBi% "fjUjB `j # 3p, `5, `5-OF1;FFF+ i s  x; ' T +Zm=Fq !{ 5     J T ^ j t   4'-?(FF{ *F!F([" 1^$(N7 Z' @# 0FuFh$+Bh 4-#!40C0 )-40HKhB !#*FFCFG #1HO0 (!F#*F&A0#x+I F( F #1@@-0"p)F450C#0*Fp#!EѐIH@!(.*юHE4T<"##Dp40C#Cc0)lQI(F#l1I(F#l1I(Fй#l1Itftptt&0ttty uu)F8F<F(?dp nH!Z)Fp*tR40C0I-41# 2BI(FZ(4# 27I(FN(4 # 2,I(FD(ФI(F> 4 H)F%40#040CS0m0*F #!^FFѐH 40 S#cC#040CS040#0׻40#c0ͻ40C30û-<1?3vO:041F8FBFKFZ(0BF1FKF8FZ(Ӭ#P4S-<1?3xO 04gAF08FJF3FZ(JFAF3F8FZ(PO:JF3FAF8FZ(p43FJFAFZ-B=!(F4H03I "F(F8F4O0p#0'0 :F/(D0#sC0I "(FF4p:F(?"I"(FF4p:FKuuu%uXb40CS0X40# C0LHǹ40C0?40#05uuuuuuuuuuuv40C 040# 02_@@!00##C0# 2RORC `C @GsP0#S0#T0O3V0OS^0ո4#0θ-ƀ<1?ƨ2#4S470'(?h+H)F-4$ (F$(H-81 33S<ԱH?" F(F  H [`40C30h#*F!( (Or(rcrH)F\40CC0F40#C0<40#0240C0(40#040C042#B"Cc2#-rHQF 40#C04{t#``-к$H4{t4{t4{tXHK-hUHC$ (4(F FQH)Fſ?"p F (F H FFH)FpF0(FF#;:!(F Fб" +o@!HF FH F1H0H=!(FF,I(F kF08FFF0&HؿFF&"I(F SF(E8FFVFF(8HI(F >Fh8FF~F(O6&2vKvxvvvvwvd!w9wBwmI(F Fp8FFUFDFHqI(F Fp8FFv@F/FH\I(F XFБH)FwO eI(F FFI(F FvUI(F FVI(F FI(F FfI(F (~I(F F{I(F FxI(F FuI(F F rI(F }F@oI(F uF6lI(F m(FF& OfKBfH&v1@񃀸aH/~8FF#p[I(F DF(r(FbF(>]!h@1,"\&(@NH8F PJKI(F FYHI(F  FFfDI(F FGAI(F FF>I(F F& ;I(F F&8I(F Ff5I(F FVx2I(F F/H)F޽/Ѳ,H)FֽFV+hBkh+  ,5Eш€[wɀqwwEMwЀ׀݀8@wwK1"*=vR[U^wwFO %h#j"`,"3 36 @FhAFFF0F:0!ܪ >>`:(F5Fк~*`%-?H4P7#P740CC0 40#3040C#C 040##0-?(F@h2+~H)F弃hh2Լ40C0ʼ40##0-?(FF(#; F{I(F8WIHwI(F uI(FDeGY.>pI0F0oI0F(~IC2S$e40Cs0w40#c0m42#BCs2#a40CS0W-?O0# 0*F!CLHo4 A40C0740#0-40C@0#-??" F(F 4 HV +> -H)F-??" F(F 4 H8 +>H)F-?߫?" F(F 4 H +>ͫH)Fջ ` x+xMxGxUx\xaxkxrxxx-OLFF &FOY 0@6n.<1H [j+Ѻ HO+٫\#`4Y  Q@,CA@+٫D#`7Y  Q@,CA@<JJJJ3FR|CFO4 F0@pG)F }0pF FFbV?  I*F FCp~FF F&B<K!J +*ѣBx*K!JHv6 1B q"[({z<FC{B"`)C+~0T~~-O {FAFF,@LqpHF(^3h81Y@>;I:F F^0L08FIȐ(FI8FF I8FFI8FFI8FFI8FF`I8FF0I8F%+@X3h81Zi FI3 [<[LJJ 0l+oJI+ FI F0耲l FI0P FI0׀rj FI0π0F|IF F0ĀP0soOr!Q0qI F0𭀖x0+@%3h8!PAfIg3hx1@aI F`0RFQFh.F(@FN!FPF}0vGI8F(@([<QDO:FNI Ft0bLI:F Fm0[0F%(F@A0h%(F@BBAI FU0C-@𦀹0+@D0+ F5I2F0( F0I3!J0@ F}f*Hg)K*I(FF F0 %IF F0"HO4:%!eeef+gheLKD2g]jvLSYb~ XT~I  F0{Kl*?yI F0-?c: 1+@ǀ F F[4CF@iHhJhIx F0Үx 0PFF(?lbBc"FhE T FUI 2*0?S"QFQJ FOI0GNI8F(?֮KI8F(?ϮII8F(?ȮFI8F(?DI8F`BI8FP-ѹ0=O=JHch0F (ѪV#`O0@((яBѪ"#|Qjx C   B)F+* FBDPHE٪z7# F#zO. 9D ;B@BE٪`#O [FFFD,B ",+F+##p-OF FFF  COJF'NKE&[ɱ.ت,7#`O0(  FU]>epF7(#ժ#`,k.O#pcAFPFK(]ъ o)h 0@_h 0Ao7\-( h 0Ao)/- -%ѩ\-OKJ`,. F[猱.\ p >00`p0005p4\7q,.?w>[7h8FuTo -C]FFF<F8F%CF(FG0PЁIJF(F0V)F= |H0 (FG=h(FwI0,Szh#FEBF@AD(EyhE(hIE(F#Q"FAF(F ]"FAF(F(^KCѩ0V#`O0ZK@KECFOa0ѬSI(F7$H<)F |0 0(И0#A)F|0чDFBDE {h"x=I(F0?v4)F |0lX"x5I 2I"R(Fn0?\4"+IR 'I"h(FZ0?H4Y"h!I hKIF[#E.#!F (?-IE(F80?%#x+4cx+@%(F I$0#` :5'  "e-AF{FFF< Fh F$**ЩV#`O0P0۱-# 0ko Ob!QIJ@F . F9F 0綁-OFFCFFbh#jju"FV#u0j#h1FoJoH Oսh"i 2"a FiIo0 # cHM F cIo +O #jSE'أj+7-5$OFjCEm S XFGF$O jSEs2DD)F@FN?F1F0?JBH#h  p01F03J8H#h0 h BFF0 1F0$J)H#h@   ,KD#h 0 # FXFG  , u B0 CFXF73F  ,n + Tсہ~9pFi%a#jBfj%jBp, `5, `5FFF'FFF<FFNF0MF FObiFBF$ F M0o iF F((`(iF D8%@ЊBة#`O08C% xLx1Fp@Ly"F1hF xiFlF(Fpy.x1hj#>0B*2F!F:(mh !F{Ei!F(F(ѩL`H/#0 K@!J H!K@!J@ x+J8^V-AFh FFԩ#`O0Fx+Ё)F#1x+x:D0А"! Fth FcgAFhZ#h{x+ѻyoC@ghX+kgxJ`eȱ h89Fh0FL9FAFx+Щ#Ix`e(瑂-AFxFvuE5|2E xAFx29FD:xFF.8x2F!D|2 +D|2%O0PF F !F"D   C"9F I @@= ,٩B7#`O4 F/ "F(F<i pG pG pG/J0FhQhz pWFO00"%I" F3#OBOq#0IH#@"Oq#0IH #""!0 H"! (`0 IHʂ0B^8FQ(hC(F#x18@8-AF>pưFB ЩO6#`0FFOr!hF  "hFOC:F1F@DOSp0~+hjFIOsh> *F@Dj+hIjFOshiiF`LT  x( T^1 KOq J HKh++P@B O0Ԃt^VCjFlCXBXApGQ Fh scgD#Q00PF" FhFM    RjF IB + ")F FoCXBXA 0 8i(0PFT ["!C C2"!FI \+0 :i-OF<]%F1K@!JH6Km#KO2qJыK@!JOb)F8 F#pXF1p31caso`#`//FAHhB`hC`FXFXxsmXihC`hC `hC`hCso`oDCc`2#j"cC#b#cchP 1F_ P!PXh}XC5xX`smB .B *FFF-c=E5DhչZоFOSF; 5hY1F(FJFW 9I  MDh OS;F 5h 1F(FXo2F>F65D*"!F 0O0 <]Cg%YFUJFF(F 9I  MDO O & }^V)}}-C&FF"#Fb!#6"!0bD0F F/.F!F0FuF(PF!0 ѩ<h +(FO0,F.DBxB ҩ(#`(FmO0##DBӣh@/ "F8F5F H " IF@FfEHF<#D5F^p FIiPF"hFQ kM     8h-Os000h "i 0 I@#jF0Fp-Ii@ih |2F CC#0C |2""!x2-Gm6FOb!F4A  ("BШx#`O0x+x++̀++w*٣i+"F0F00@ꀨThV8O0+)*+hաxF(" $ h> :SFe0x+!ij"8F "8FxlI:F0нX0jj(FlB|Kx+++xKh0#Zx* [h#  0#Zx* [h#P 5" C )FF     (OsX0;hBIf0wѨh+Шh1+:I;Hx)("ci0Fy+F*;+ O1 !0F m*xF(?:(d(F7hF(Fx(?箣h@/"i%iBx+Ү xFVByy(F D)#Jx)ѽii@^ KF#!3 Fd^+  pG+#`$`V#` F+ F#` F$`V#`FF+I"O0pG^-A%FF )FF"R! F(7#``1I2H``0+F/J !<+I5~``0Ѩh+`hB&IjF^0 нP-ѽ0c H`hC F$' " I`h <0I`h40AF FG(I`h(0 a`( F.@$qB@/lBpBfB@h-OFFFO#`eiU`hCF+Fh SFh3SsEF*Fh(`bi cDB.ؽBD*F h(:FQFF%hJFCQF0F`5i]D%DciaB!hC`?HF #O9!jFI]gBh-AFذF+("L5FŔ x"hш4(O3jF!8F,I#6f#`O0X4("O31F,#8F"^B0h%-O5P*PI iF @$P#"@h 0! FF@hVh F@!Fw0O0! Fn0I`h0O0 ~B FVű.بB#`  `(Fmx` hB٨0"#(F#;`BhhB9`3,1@pGpGʱh!NDFBD`@@CF5{;D-OFF *ب#DKB ШV#`O@F$F#F&F"FB  `+dAFFF˼Uмl QF, lBБ Eؼ4ѻxFE\DB!F#(DFAF|FDZF+2FѨb#`cSc FFF0\8+x #pO0 FFF0F8+h #`O0 FFF00H+h ` O0@mShYh[m#e@!nK hJ nO3#f03F$9 F@8F0P33S< Ր>0+ D&0ke#hx1h"8dheB0YmkmBRh033S<Ք>0+ H8@ 2fpF F OqFU0`X+ha K0#h+0#pOpp@B0 0cSc-OFŰFFȀFF3 =H ?O0E 5HOs. ; S<VOq F(d0 `ñ*/h( B " JBјh ћh`#+p(0> kpS+ *p #@h#k ,q"}?qL(~cSc+T sh`rH $.D)(D@B/ /d@`6p.(p**(1Zp(> 0>! A}jF*@# FHHO0e0F_]p# `FFi0/H?.KBBAXBF!ѧh+&Hi k'8F ] i H"F(hBC!F(FJ HZ(h81E[ 5# #F 0P F0`H0"F`Z@g $q_8#NFHxhuF4F Fp*F!F:#sU,FF-OɰFFRFZI8FFR(l(hZF1FF(tЦ@O   PFBF@MHHFIOFOrKFQFHF<  6#2FIF(h[F 5 4#2F[FFU 0# p,0+DкD xܠQ @#.JOqXF,wI &I;F*F@F0ihIF(HIOp$II;F*FJ @F FNh0tII;F*F`@FVF NI`_@˄-GF"M FFUb FO, ,62B$%B&F, ѽHv V,XB3BѱFV ,Y,HdFHFO5,6#T ,5T,HRF0F>_؄*-CFFا#`% FB1F y0 B O #DBҧ"#1F y0O0*O!FJFLDI ICFF0Fb0T IIF0FV0|rg*pFmا#` $ xV+ѳ(ьhIIF(F20.)F y`J3F@A0O0 mp I(FQ0r#` y@0>5 31]aS0[#hS +#D(8D 0-O F+Wh@`_0Ֆo0ZFAF(h#!FK ZFAF(hy#F(ИK+Aا#`T0@$P0RZFAF(h#F(GC "E=(FF(V;  89F(4$SDSE66V<0h0  kH5V  Z, *(FRFO4 BB BO2! !"zg*@AO(`A@O& C 0 8F"  89F(4@Bo@Op F5 6-OF}0 'F&F`F*F4#AF h^0`.i.\h.Yѕl0+@𾀕,0+@Ӏ#h&O,r#hp2Bހ0&O,30w0p347B΀#h&O,lr#hpp"BĀr 0O ,73 h2KE 0 '80g47B 0FHtIZFFPF'0O0 } ( #*F0IF# h0(p8FpIZFFPF0 , #*FIF h0(i8@H8uIZFFPF0^0FFH&mIZFFPF0ѰfHfIZFFPF0ѡ0?=#Or@! l[I ZFPF0)0?(TJ@#@! ,~PI ZFPF0n66"6/W,<&P @>0g4bE;ј)FFx0ZFQFc4K,  hVW,<}+*0h!F[[6QFS0ZF$K  h7  ,71hB2,63h PB)F hMh0ZFQF Kc  h 7,63E!Zr@ 8FP5 F #d8p"$IF CF&#2FOq0 FO4 Fp"! F0OBOq F0PC #0OC0 +h" F 00FhFP8129033S<C.iCiii iBղ# Fhn0CF(f He F@&"Ku0IH@O_Q \e-O&@Fh$ hdciciai#bhca#ifa8# IF(F 1Z<$`jHdFZF1FFHO3#cKd81@񜀙I(Fd!OsC `jH:1FFHO3#cK@0 Kd#kZ `j 3H$1FFH+؅H"1F##ckj :g{' {{zck#k:{{ z#h+;cn+8`jhB4єh00H#k1FFlHRB iH:1Fg{' {{*zukB#k1F_H:{{* zb`jH#k1FFSH<^li+NДh Iaii iBBk+?#h+`5 h#F"1Fdh0 $7S : h1FK+2 r H1FF HP F@sHC1FJJ ЇB8 PFHJh# F3d8@J!& 8FP+h;+h#F J!hjH| FH# F+`k# Fd8@8 6J! p PF1FH1Fk*kH hJ#!+`#F#c Fd0p@32!a"2Os J!} FP`6hE# 3F F(C0H #h81T,I Fd@6 F2F9FH#h812  H@9F F!'2F9F 2F9F(a F0K@!JHH  #hf+` (ah F F#$x F@Lj ` !h0Ch0"*-CF` F hhiBrjBX0F(h3Y {ȀG|IFF&H8 hiaі@0 F)F" F3F!%#F"!I FdN2#C"#[ [C#h!(F h"!K%f 0Fh812>#F!Phih" F# F+`# F 0iZ#+`i FQG FHg F 0@C 8F0P3 FFȹ HHI Fd8@H (aH F8@ 288 PF H Flh0 FCh0#d8@'J! -GFp7X<@hN233C23 +FFѹHG"K0ѱIH<1 23ѮI" 0(F0ѨH Gٸ@ &q"dhDfXc(FG8v2C(FGݽ33CH (Fh a+>i2F(F<hFHEXq1C!+@$#i(F1F#@0ci1F((FFPF`a(JhRF#i!ffah0Ch0(hh0KE@X<#k3(hiF(@ހ^?? "k arEvRH h#3cbGH##cckDcckDc$0KE@0@,#h+p##`7dX<C (F!80H GXl?v3C `jG$ F%H0+fh+c0KEe`jG FH(F(h+F2F!cuX<2C(Д@ *K(h !<(FGb,`Y \e0`nf cSc(hK+iHEX<F#3h+N(FG 8 0FP33S<H8h0Ch0# Fd8@HD FI hiif@Ա#hñ10sdnDhB#I]Ka]KpGf-OF0PFFF# x+@HhkmBCF:F1F F'OE> **(#j+:7 cE85# 2F h;F0;#0 ?0"Fx;33FII e" ^"\" B2BG FHQ#Rh B30ՕH 'O,+h+ѐI3F"Fx (+эI3F"Fx#O L pB:F h1F~@}I3F"Fx @P3+ѹR60Y6#2F h;F0oI3F"Fx3FmI"F x1F h:FF@F eH0F+h +#h81_I FX hi4 h!ZK*m+m##+e'[<+<##F 0B"1F:F h06+7#3+[l#2F h;F@*h*@@ ѹ@O !2J **XF|XH QF&KFBF)F FedhЋ-OF FFFeB DI DH+F OY-! F*F-i'x@*dbz*a`HB[.VBR T' $ RF½(.(B0DB?ӽ& O:h1F F""H2T'½0KhP #i"POS 0ʊ !PF(FFXFXG, F H !DHF:H`p)`]F FmIHh#`hBBiF FvAF3hCH  I(F ]phiF(F1`.m,T`6e$-A"hhF AHuuh- xhF *FAF Ht0+1h;*FAm+1h;*FAa`/!]P eFdO PFX` `c C    La` X`$` Ba`O0YaIH&0n "FC H !] dh`0Fwn`6e FFh F!8F@|i[`iXhU(Q FN,hx1h J DO32CO32*#38 h*[h7FP50d000>3)S,&B"C,"* *S,BRB"C,S!DBC,a C F0@1)B"BbO`z  F Hgjz S0+ hK*F!0zDR 8FP#Fh!JEh0+ h!8@:8 -GFMi@̱!h(cnB  gH(F #(FdIcfR(F0F(ѳiZY)h˱ihBF0 FWH033S<w/(F*hN23C bjhBєh#(Fffh03 *0r"#h ++(F(FW033S<s;C(FA(&Cici acia+?}kj$'O F/'BD  Bbi0i2Fx)њ2@*٥| #`7/ K!(hddl(FIYx1 DpqvfpG B F*pF٥D#`O0p&F`!=dB*F"@rBU0F( @CO `@@O o@  OpXhHh hBhhB0hJI Fh@Bhx1h F" F(dhx1h F h[h hhb@h"Bhx1h F h[h hib@h"BhHh0+@n8 pG pG@ 2O0 ciPiӱ(Дhh *ñ( J0B O0( *XBXAFcScx1-ChF  4#jpbj ѐIb(*F)F0FbF(@܀dh;h+їh0+{n3KOqJHIb{nh FRF znoCg2@B{nh:#)F90"F00bt("FO 00bfF-Scj%00 F F(#yn81ynX1)F F_F"Fb2F(?b)FbroynXxXCXg)F0Fb0B1(F8Y( hrF(?f")F!F@FAF|E)F"00bF!F60Dkx+ (F&8 HF FF0FbFxBIF8F8< $B")F+  ЙB"9FLS{`#hBC,HF<"> F>H F;F(?Co<CCg1iFO3)iF8#" Fdg11X"!0Fb\FHAF0FbAFEE9F0F"!bFF(9FbYȀ?{0`j3S,ՑhBC,HF<" FHe#cVxPpF0+K@!*J+H*Ai )H 1)F CFѤ~h1+Фzh+Фth+ Фph+iiJH 19ki hܱhhB#hhhBaiPah{Y`bh F`5knB#h0kf0FpQ`F}~`#$8F@L fF H F8#0`-GFFFFF8?H$ F10 hHh;hhB!` F"9F(FF(M4 %F(;hEa`#a#a 0`0#a8h F!FxFJPFHu0 ##`  !@F퐹`hCh;C`+ڒX (0hZ`x +-IhFu@(-&1Fd(&IhFu4$I,hFu.( "u(x+0B+K"F47Gtx,(  pC+"BJ" ` (* F pC+C'(F'C'K[h;"FFg(HH( C'(J'F<K8GC' 8%L`h%`"e`8C'F  "F! 2K87F ,HC'(J'8+FO*` Ȅ ,`8 F !F" K87F ,HC'(J'-OFFFFȿ`O̿OO8m0@F4`hBh [(QFh(LE!FIFB LEE$0O8U B0 pG pGpGpG pG pG-CF-FSOFF;h8SPzhHFu@ #;`  !HF쐹xhCh;C`+ڑ (0hZ`x +#F;I hF u `-&1F(1IhFu/I``hFu( "up(x+Ѡ`E$IhFu( "uZ(x+`hFIua(IhFu(IhFu(IhFua(?| IhFu b(?t IhFuz`b(?l:!(e l@J'#L`h#`uj IH``8 @J'$ K[h L"OcFF0"80( @J'xJ'F KFFF[h["+FFFgH %`(  `@J'FK8D@J' 8%L`h%`^e`8@J'-AF FFF #F*F! gK84F P @@J'JOc0] xJ'-AF FFFD #F)F" gK84F P @@J'JOc0] xJ'8@P@@@ @@0pG-A4F N# u(F !'F09+F% +O8F$hhpGHiSipGpG-O FFAF!G@?F@D&WKOz hZhFAFDCA9FCD QӢB ӴOغ_=#cC ?XFiFFF|N'FFFF9FF @0F1FF 8(F)FF 0 F!F@F O30F FA Cc"*BFܱB)F0ѣ@"h_KhFKIGKz #F0T ȓ|N'-AFNh3б3i( $3iwi@FB8GD8FB` TF0 i"FD$!FF(D|N'8? M$?i*j#DBiDa8 F( |N'𵉰FM$0+DLEKEH&hFFG&hAKCJCIDHGDO& CK%*;FAOBJ(z):F@OAI&h(9F?HG#h* >N>K)*3FK JF HGK$hHFFG |N'T &ϿȓNn̿ʿȿƿÿ%4CTbgiFizHjOiC(D#@S@a j30B P#@JjOi*DC "@b@E! +a3-OIMD+lD(#XC00F(tCI0`.h$4 FO ,@kBO( O k ( B%O( O D+l ( DB/@FHF-II` 1F04 ( F 4"I`k+k 01F4F30F 4I`sik 0F"D4@1FjF KhR K IFG+z kl|N'``T &p$NjulB(hpU$0PE$4|N'K[lhpG|N'-GmLHP-@zT"#!O #,#3`3FUM0#b(3a `O3dHObC#T??+@  ѣ $0qHmM!'h2@geB`F`c@clc#c:"dZe@Yjh#e@iY!a#af"fca1)B!f2f@c`'0C#SH "1F3`PI&PH` xLIg`KH` 8j`nF`d(@ mAH_RF (?{#0u'm/sA9* &,7AJlx~"(.=CRtz##rK##&0E##%0?#lkh2B8;k`4kh+?13#$0*#h+%;`!lh:B3h+;`|N'T U g`N'O'lh:B3#'0##(0##)0##*0#3p#sp K2F IGj1FX(`(?>#H0 9PKH0p pG|N'K h pG|N'F2LFoB40B0 r0BѪBpBh0BhBр`"1F(F'BF(`ciaH`ciD1F(F0Ѣ|@"iFh^Kh.KjFIG#z ciBF(ci`aH@|N'O'T ȓ-GF9OFF=il @#i@"#aO3D  0 0&0"&nB 030Da`{nBO jHiDaVaciiB !F@F`i!F@Fca_iB#ia{h!F0`&0K,yi!,@yi FG|N'0$BKlD0v44|N'KpiB lC@.j& DBЛ@ DhXipi@l_|i|N'Jpil  @@@"iuBeO4 D0Da bTiDap2|N'-AF_O:iB lh@% DB{Х@Dh!BFZ! F2{j2Ѹ%FKD00@*iC !P+a@i Caki3kaiB-:hB##;`i)F0FAO1K#/03 ,KO0CCX AF+8)F_+9hB=`BKi+8_j8)FAP@*FZ!>*F!Fl_FFl_x%0#"iZ!h&0@#`|N'`-AFki+;!F(F9ji:jaF+fЖ%)oBF!FF\ #B7J Ӱm;hD!(D(#t04Fh F*kO4DD< "FHF_F(FHF_%`i8FF`#O0!jBi3 O1!E# #+aika3B `#FiD!AFF* *BF|N'T O;iC 4FH FUF80`3`%(F1Fl_x%)"F!(FT*0+"F|N'KF[hBh!F@@|N'FNH(0+%(FF)@LKhlKIFG #`'0C H "#5 Fp|N'T &g-O FF(@8N-ؖ)0+Kh,KIFG/(0+@ 'DkBGEȀ4hE٥B shE AFF~ѵi%" B,##𤀫EqhKBxl%!FFF(1i < l Ѫ@3E cBD@HF3ZK%*F!2C66   * E  "HFGK HFl$F3*0+*FPF>$9K'0K;H "#7 F tiE(F_3iEK(DDFH FF0P+`K)0KhHK IF 9 Ѥ  D )FH_% BF_*0+?BFF$FF $|N'T &0giN'𵅰FFj/N(U=FeCі(0,8/6Ж)@,I(Kh'K'IFGxDo+9F(FBshB)F^F(*F!~'0CH "#5 F%(FF(Ж%)oB0B*F% #`|N'T &g-OF4 F(0\%'0C "H t(F $/ր8F0BF_\ B0ҐB F6 (0FO3*Z (O33BI!FF(𦀴B"F9F8F 40BؐBӘBVKXhbs"#@@B #B*0 B=F!PBo cBS@  ј%0+дB28Z!7 )|0B0B!  J2H_FF/H_`0q" 8FSFCF&HIF_ FF@0B?~2F~ IFH_%0[B Ҫ(Z!^-! *0+дB٢!`)Pu Kh K IFG FF #`gT N'&|N'F K'0CH "#3, F@4|N'gڹpGpGpGHpGT HpGT K0h3pGo K0h3pGo K0h3ppGo K0h3pGo K0h3pGo K0h3pGo K0h3pGo K0h3`pGo K0h3 pGo K0h3@pGo K0h3pGo K0h3ppGo 9 x` x pGFpGp pGp pGpGpGpGpGF BpG\*0 pG-AFFF$;F"DB FF h T !0B"pKhpGl yhF;+`ڌiB (]K h\ `p]KpGipFN$V4(F Fp4 , lbK +K[hG pGlbF0 S pG0pG(h9!HBpGXK0h30o O0 pGo @FFR;BpGFpG#BQ#@@#@3K0h3pGo K0h3pGo 7Fx M K*Fh(I+F"FH0L%Fz&=g (9 xH+ pG pGHpGT KJ3(FFpG&\;+A,A 3۲, 2ҲBГBO0 B+F-OhF:VF,FF:V1OgK@ --+hC@`.@TMF;F$s4,Of@ 1F_-F`"`=F`3J=+hCV`.TF&"!hF ihB X( I"|BFA "FiFPFF&DD-A&K ` E.-$.`O0"KFXhB+6`3.-$++$07"l8FJE(JF&l{$`/?yEv #`.i`#^CY!k`woKhBKhS HpGFn KhBKhS HpGa pGpG pG F H I FrfHh IFHNI s@HUg 6nR]pG R]pGFF R]pGFFpG pGpGR]R]R]pGF|pGpG pG pGpGpG(FpG FFCBС,#` I)F`J!Fh 'EhFhBӹh "` J"x46@d(T`x10: (o O'FqFbT[ FxCOHчB0BO"PӳOгOJT[O+Bڳ OhEO8Oг@OBF F FB<%xE%hxCOгOгO40COгOس@_аس_г _O0#hF00[]h;iP!0xCC@! pGh`K3pGO'8FCi FB "iQhF( F !F8 hpFFFS2Bңi5C"iYaB#Pp3#S(K}F{i"OQ;a#jjBbj2b2BFx^*3"`OQ#jjBbZj2ZbFhFi i$HP&`S/B2`jB2bBѢikR:Df#iQUiFFAi)DlXi#ii+Da8FF FFFhi.ݶ##/ݷ!! D+>n{9Fa2+FROA F;F" FiOA FR2i)F FR"OA F&i" F9"OA F@V+FrOA F?ZiOA FR i)F FR"OA Fi" F9"OA Fi2F F`&Fz2OAR+F F+iOAR)F FL>?Fe)F FD>F^ F!@F(N FF3h+#OsB3#@\ CTkCK52hh*"Or30B#@b\CcTK2hh*"Or30B#@b\CcTj"j1Q 8F !@[jbZb Pl o o -AF`2FBSBLB Tx], O ,0xF+`!(F+ "F1F@F8@FB8y7!U 1BFZB "`xh #`KZc`x[)Yx.)3`2Bӣh #`K3YBx.*Zx]*3#`O'JKh20')`) pG pGo -AFZSBF FSA'0ip0iF FG2BҔtu(J)8YB;x\*GZx|*D0iF FGhKiBѣh #`t0+ZДu!bh#hpB5 bE1ٓ\,ѓ|'31#`x|*xBoiF FG3)YBxB[xBBғ|3Q)ѝɱB! F6+  FiR"iOA FDc Fi DOA3OAi F*i FSRi"OA F3@O'pFN$V4)F4 p , `w)KS<GFpG`wF)K Fh+#OsB%K"jh$KhBak#B&&cjB/Ӡk\k+AX@jk30o30pB60BѠk@ B2"k2# Bܰ B3#j(F3(6l o o -OFhBh'kB"I(FFPOA F#h3#`"I(FFO A#j@"hh1Q( ! FOD#j@"h`i`!(F#jiD#c2Bx^)3!B#`c x]*3)F F#`t-*nNB x]*HB@-*@Kx]+@ `)F FW2B@h+\K3=1!`Bأh #`1Ff x-+]+ѣh #`1Ff FcEFҙ 320 ԩ ! F2Bȁh #`fh #`f#`JF   O F(F FQF)F F  0+#OsBij"(j1P !kj(bZjb 1!`Bأh #`1Ff x-+]+ѣh #`f=! F)FF F2BJh #`fh+#9@O'l o x-*@*ZB@&Yx])""`-( F FEKh*7Eݢh "`fh*"OrJEEZF)F F  UK3#`E߮ik"(k1Pl !kk(c #3kcQFHF(ݣh #`yK3O YFHF( QFXF()F F  ѣZ"`x]+h+Qk;#jiBkxCkp|OFF0+"OrE5.j+ckk+`kj+]k+Zѫjp{U9F F#jjg)(k%@>(j!7D@"!(FDB "jh;`#`i+#OsE O\ AkX@PkQF(Fñs(6WF6.K  (Fh3c(*K(Fh3Z#jO@Q FhOA-* ! F[*Jx:*?"=*? F1BFҮJF)F F[YBx=*Zx]* YB:x:*6Zx]*23#`l O'o o j FpFi(KI h1!I h10Be F#`]#0#0 c` =e pIOQ F p@Źo o o h-A^`Fxi\-[-zChBӃh #`Nf`s#`2x@)BuB@&!O*-.-MУh+@#hՠo( FL}-ܵ"ڵXt<+|Т0O`Q F2FiXXt, F12FOA F[#j"Zd""OA FK@{B ! F(ji;` C`_Kh0BF*)H"`;FiOA F2jiOA FiOA F2;FZiOA F O Q"O Ah #`=K3! F i+?Wh #`5K3N!B\\)ZZx{*W3 F#`1BF0x,*-Z"`B+(J[xh320Z# FBFݢh "`J"*F9F F<2B"YBx\) Yx})3#`+FOs#`B3B\)x}) ! Fj~h+ #`$XBXAtO'^ ]o ڮ"jOA Fl^d .2Fb^2B YBx\*[x)+)"\! Ff .OA Fid2F?2B>YB:x\*6Zx)*23#`h^`Fxi?) ء$ڲ * +#^)׀ [) \) h+ {)|)!ChBӃh #`K3"jOA Fl^d .2Fb2Bx)+o)! F .OA Fid2F2Bӣh+~ЈK3Z"`x)+ 2Bx*.?){)^B |NZx6hW6`v,*Уh #`tKc`3#`0h #`oK3?)ހi*)+FOA F@iOA FRkiOA+F2 FRiOAR F[1BXx*(?*{*NZBJPJ[xh320[A ! F;#`}! F"OQ-#j jBbZj2Zbs"OQ#jjBbj2bd !ji Gh` C`1KlgPO Q FJaGChBӃh #`$Nf`s#`1x<) >) РoX F/"OA"O A!iOARpi+FOA F2RiOA FRi)F FR"OA Fi" F9"OAJO'o ^ ] F2BF(x,*%Z"`J[xh320Z FBFݢh "`I2F)F F2B x})3#`3FOs#`BF x3}) ! FAh+ #`o O'+-OFFFN ІhBGvL F KB #FF&!V%0$ F)FP" 7D(uO&a H)FI+FH%KuPO5"" " R""tpOahF!+Da`#B #~K32BJ"OahF"KaaaP ``@ #qK3c`@chIFMFF OF0XFPkxB@_->ز_!زo𖀲_kB)GFc#k!cO1ZhFx*F)FhF_tв _kB@)c#kGF D)F#c)1OزOزOуFOOвOOI;زOFXF&xFhxBO7вO4вO#jC#bk-@怹@!@"`c(r!(FF({Ѡc`k(΀#cc0O pF OвOnkB+)GFc#k!c[)F#co$kEO3#c8Oв@OTUU7 k+ : A+ O'-F5F{))DGF!c%s))D_hCbcW+xF_+B%u#CUAFrC_Bjk@!0;|!(Fc0F#zk;9FBA?3+F*F<WB9`:`B2V# B+ "F,0Bj \E;bFP#B@#@# V#09h3EGGB7ӝB0F*@ehFF5UxAO.бO-бo#jC#bME##`#ld @0Oe#0#j[ #K3PFPhBV" k+?3B8F; * O'F)K Fh+#OsB%K"jh$KhBak#B&&cjB/Ӡk\k+AX@jk30o30pB60BѠk@ B2"k2# Bܰ B3#j(F3(6l o o 8FK Fh+) \k AX@8k˱ K4(Fh3(K(Fh3y8 8@ql o o -OF- F첑FFLBءE@HF2hShS'PxAO`Bر _ر_Ӏ_〱_ OVO𵁱O𷁱`_uH@_𘀱O𒀱O JF!F0FSF(q%xED0O,ر O‱(O}бOsiBZ"xS10 _*O3iBshXhBF,S10+=_*J:8O}б@O3iB"xS10 _*5_,9a  +a*ѝШb~o -OFFFFB0F;hO YhQ% xCOгO]гO FOrس@_Qس_г _|4F&FUF"xHOD JFO +F1F8F8JFSFFF8F-E[b#xCDQ(0xBO JFO+F1F8FJFSFFF8FEbbFOJFO +F1F8FJFSFFF8FE*bOiгOгOѹh"xBh QP`t5"F1F8F+F(?v+F"F1FkF%"F1F8FBF2FYF8F(WF:hk=ORhR "xBD"F1F8FXB:hiRhR!P%xE DR% xBO=h"xBh!-OF- F첑FFLBءE@HF2hShS'PxAO`Bر _ر_Ӏ_〱_ OVO𵁱O𷁱`_uH@_𘀱O𒀱O JF!F0FSF(q%xED0O,ر O‱(O}бOsiBZ"xS10 _*O3iBshXhBF,S10+=_*J:8O}б@O3iB"xS10 _*5Fi++h  h  EJj)bk*8k?_DEw;xR#0+e=   BZљB! @x(!DD#DF7#k+E8F' RFYF(瀸cl+? ' RFF(83HFF( |D [\#0R B,?qEP[FSEF8x3 xBkB8F  (ѺE~3Fzcl+B H l0 (?O 0l#B\ blcC\ ZFعFYEh 2 F([Fw (и?| ¸Oq1Or2?i $@E( 6  =F(EM3lX#3 ZFs+0o( >F(& &&pGpG pG ~r pGpG pGpG8#MF`+x %`8Oq(FX( O'7FM+xD 0(%` O'Fhx[@(/! Fr8  # ``pG!` ```pG# ````pG pG pG pG pGF0JP!HHH P' (  pG pG$P0/ 2#0/O-,MP@P`TpX0$p`R0*$0S$00e 0Z 0000\00 00S Q^A 3 # Z20# TP@PY*   T0 B2@TPT00#03R0S0 YR00J 0S1\0S# 0, Q 0S Y0Sr 00C 0100R 0!03S  [;[ 00,Ѝ P0030#P 0#S 0 RS#0 S  S0#3RQ  PR# 0 B0 0Y00S  000C 0S00 0S  AX 00S 00J 0S 0 SEH S0 0{0 C R9S+ ^0 [ 0 0W @H! $Pv$0S,$0C[0Sm  00,Ѝ 00R3ZXr0  H$00CR20% L X1000S 0!03S 00C 0B\\00S SC @PTP>: 0; ( $ 020f괇 @-QM@00(,4` P#U `A0``o "0# R0o,.\U-00ĵЍpFW`&,- M {Ѝ@-QM@00(,  P#U` `A0``o "0# R0o.,^VU-00ĵЍpFW`&\G-M0p`@0W PV P%Y P.X PmZ PNx P4 P\Wf  \ \V+  \ \Y  \t \X5Z! L \< \ЍYXZ-  \ \  \ \Ѝ \ \ZVY  PЍGP < ,  ܃ ܃ D T , Ԃ ܂ O-PQ Ml00R` 000 p`0 ѷ@P @0S nSc a0CS0 lPL lPF  ЍlPzZ V000U000lPLZ V070U070@lPZ| V000U000lPZ V000U000ZW V080U0800oS slPU000V000~0@D`lP 0ZlP TlPiZL V080U080]ClP~ =lP 7lPSZ8 V000U000@U080V0807U000V000.U070V070%U000V000 ЍU080V080U000V000kPZw ZpkP XkP ꜂ pā ā \ < , $    L  ~ D~ D~ A-P`M_NP 0@H@>SJM+; D 8"` `P!0 P3 P0 p+ 0p ppp@ ]pp@  p@@@dyp Zpspqp 0PjpP`Ѝep00@lŸO-1MM @PD 08 "( p C.F D`pX;@D8 (@s0Sm pıp `  ᬱ00$ %0!`t0p@ !0 PP 0S Rp001ݍЍp0S 0K0S R PMp 0[8D<4! @P 0 00Z  0/0h,R gH1ݍЍp} | | | | { 0@-M 0P Qp Sp@ P * Ѝ00 0Ѝ0@A-@@0s- nPP0P 0'p` `3`0`0{oppX`p qo``0`0eo 00(p@-@PCM0 /#_P2 @@pP@ ` @Io00t1 5 @0F F 0 @P@c0S VS00 SCލpx@@0So@0P\0\ @0 T P@1:o?00@o00(x 0x p@-MQM@P4SZ TE /^PB QP0s* jPQa P0`'pP @ @0|dqpG D p@ ۍЍp/0si/%@@ 00p! +gYn@P0 @0  P@1:n?00@`p 04n0#S5p@ n00n@n@PtX lv tv @-sP`O-$(X,p1S`@P.Wz00Sg [0 0RP:%"K Y2$> 4"0x""2"2BS"2"2@0*rW00Sd [0 0R P :!; B@T"#.P@P@Pt0 {0Qu w{a hR P :%"; Y# [0 0ORP:u' 00{S( w{T n 0:RP: ): B@T#P@P@P[0 0!R P :Kz'Pw{ 0RPv: )JP= =MS= =O0j2 T$>0 0 Pw{M Q P W:5# B"2"2BS"2"2@0K"20S$. 0 0 @P`= =MS= =O0L7"""""""@-DM@ P- j jBp m>BR/ p=QY p>m>BR? fP08 P00 F< 2$xpPELSp F"x(  RQ8F#0 S/F P\&0sF `0d   0 Q0*0^* V r0sP  T80< $0 h0  0S 000000 00 0$Q0SP """"BR""""@ : " R Ό0 0 0x"0$00$00S <P X \  LR@0Dh 0RAP  $h (0P 0v> 0`0?d000P0?T0080?<00@0?D00H0?L00/X0\ 00 0`,00,0\P0L dSl0 F`00d F0FF 0B ` =(00(097$0SM"x-F00(00# V  F! 0  ! 0 0S(0S% 2/0 S * c 0,0,bE28 S0000) < (\/H4 , #:0L6QS00R0">! 0# 0E<4 L , 080$2#0 0D <0@00,!ςC!, \0 R0.*,&R 0 04.>Â0!2c,0\<8,"΃0,!/#148448 000S, P00 T '`00p,(d@2/0, S *P0 0<R$0c h0,0000`)L40E(\/H280S<0,0,#:Q 6S00\0,>! 0Î>c80 <8,0P<4?!̀?0 0"!/C1 ͌8 , 0< R00 P0#50  0C0I  BQ@ $0h0  0dR,0  ^. 000 S04000Q4` , PTd 80<  \0  Q00000SPT8< 200/, S *($^0<P04 0=R4%0c @Dh00000,_, E)L280S<08\?H40000#:Q6S00R0">! 0# >c80 <80,<P4?!̀?0 0"!/C1 ͌8 0 0< R,0 P0#l,0 R  \Qu% 8<&V Pj#RddP0(00 6 :Ϡ6S P00Q$0! !>0%!E!2c 8P, \?H/)L0 1!̀/0,0S400#0S > , 00 4  .1A0H L h000,00 C00 00S ^< 0 h0 BQ0 D00@ h0 C0000S \ 00 $0h0+;  +; ]sp; 0 - -MR- -O O-Mp`4neK@00ie0W0 V& 0< 㨀L   ?0PP o 0PP@v> 0`0?d000P0?T0 00 4`80?<00: <0 1:0K2[4+04@000  000T :0x0PQ 0TP dPB PC 4`P~0S{ Rx R t R p 0 0E 0`@Sd ?@$ #@TET0}N0`@d0d0@pPD0 v^DP PEI0H0|00 0G 0X0lx0000P0S0 Cp P p p($ P\,P'   "4@SR0S S00x@0U0Y0Z0W|0 Rx0 R{t̠ ZZ<8P0>C0: :J0p0t 0@`P Vw x0S wdptp0H00@@D x0@0P 6 ?O 2 0SXv 0 !"0#/!! p . /J㨀l B p0S!w0'0S00#0S>0 Av.@ B Q PS000S Q0d00qpp I 0qp ` VP@ 0 ?oR20Sc0 0ߍ!c0x0<!qp@7 Q"0 00R@,NS) x0 P0,P[000 `0  ZR 0`S 00@ c0 0x@c0S 0 0V0ZS dx ` ?PxT0 ?8x<0 ?@xD0 ?HxL04`X\VZP O`bcT00_c0S'@T9)P L@(|r@"bW02/:"  @b"R0(Ec0S0 \TP'jLPP⨀& @@ ߍdT0/ 0%)$B@C "!!b0C0 ,U0U @p0!0S 8! B^ 9  0  F_qp3  @8pcb#00b0S@̠+x00@ ̠Z% ZZ ʳ!b!Q  s!P bT00b0Sd @0!b00X< 0 "2#@TÿbT00<D@-@m aBIpTL00P 0 0R/P/ /DH H  DP 0 H Sp@-`P P 0@ #  TQp Pp /0H $H H  P/j.0 0# /P/Px000@-PP Lo>O@ 0" P0 0A-@P @`pP0% P @PPA-`X@@P jNpP0& P @PPA-`X@@DP H@pP0& P @PP褝O- M` ;pP8 찟`萟 PP P oN & P @P0S  Ѝz ,/@ W Z *G0p0SA A-PpQ `@Q ZP@D 0DB(000S  @- M`ppPP( ,a  ;00S@ !a0"S" 0p000S0 7/ Ѝ a0"S1Ds\0pT000S @ Ѝ1Ds$ HXTN M @-@ @YO-MP@pU  PP2SoPR pPV $P` A P@ P) 0nS: P= {PP p00Q Q P  IPB"0 qS 000P Ѝt0 0 0S Ѝ0oSP  H= O-BMM@pa`, 0 0PP: PPP  PPp00YP C `KP@@6& 0PPUp 0P0  0PPGp H3@P$ 4z40D0 0 dQ`k`V`pP  pw w0 [P @PP0 PpN c|P P _ 00BލЍP/U ` P ,p;_0SM  tJP mJ0H 00PPp<  .J_t 0 0TJPT! 0 0 0_0 0 0AJ0P`_  0 00P[00)s_ 0 0JPh_ P0 0Jw]_X 0 0JPmK K , \J (I I I H H H G G G -M 0  VPЍ -M 0  @PЍ >-M  0  *PЍ ?-M00 0 5HPЍF --( 0P    0/ 00P@p@-PIU@p^,0,? 0`0  6/pF p@-PCIU@p^,0,? 0`0  6/p茙E @-M@P 0003/8E @-@P 0003/E p@-P'U?o@20Sp0 003/ꜘ@E p@-P`UV00P00@Sp  0P5/0D p@-PU?o@20Sp0 003/ЗD p@-P`@Pp<^(0( 0@p@/጗D p@-P@P p 0 003/p4`D -@- M  rsp@(0$003/ Ѝ@ Ѝ/ D @-_sp@0003/蔖C G-`-P@ M 0 0zR0Sp Ѝ]40 ,0P@:/PC G-`-P@ M 0 0j0Sp Ѝ]40 ,0P@:/PB 10!Ph /////x/p/h/`/X/P/H/@/8/0/(/ ///////////////////ᬾC B C PC C B |C lC XC tC 4C $C C B B B B C B |B lB XB DB 0B B B A A A A A A A (B x @-@$ MP05A05#05!0%0%1P$00$0Ѝ R/,0p@-S@p(P$ARp$0S* >$0( 0C\ 0 C$ R*0#$00S$0 537$ $050;B,0!PpO-DM0PfYp0 0 0 R0   Ca S R R%3j?F$0P$ 0@Y Q< `@@ QQ3 Q0 S0A1@ 8,0Q k S40 5,37,050,00 00 Q, P0Ç0,  0, 0 Q_@Q8,0P s S 5>37 ,05 5Q0,0j 0 CQ * 0C,Q*0#  ,0 0,0S 537,,05 50S; 5A7,05 50,0SZR0#0C RM00C G%3j8G$0nS 5<37,058`0,0= Af[/o" R  :AF[oP f[ 0@AA \Q[ 00,0S 5#37 5,050,0 QS 57,05 50,0S R0#0C R00CP,@DЍQg p`0 FQ)Q* AR  bQZ fQ ?R0@SP p b@S7rp B:p: C#s, 0c0#80 S ,0 S40 5,37 5,050,0FQ0 00,S Q 5070,5  ,0 5SQ@f05= 3 7 0,5 ,F[`0O%:u0@$0?Q` R]  a2! A,0!  @`3 8 Q,Q 5<37 5,5,8Q,  P,  , Q0@`0 _P# P QP3 ``` VRQH[  R S`` 0P`0\ P\=Q,0 S 57 5,050,000 R,0 Q  ,00,0 R`0S 5<37,05 50,00803Q4 5,37,5 5,y ?R0@S@`0"-M0 0 Ѝp@-M@P `00 4/ЍpG-PRM\  `Up~P*a@/4JP D1< 0p00p Ѝ80S  1< 0 p00pEZ0S Ѝ贠 ;Z0S 0 @< x0< 000@ pp Z0SZ00Z00:  l3 `] 3 l6 @6 (@- @MЍO-EM MqX@`PFp+D =V0P@(T 0 1V@0PT 0  Q ` OD KDVEލ ЍY00Eލ ЍY00# 4 @-`@M pPTP) /U R rR  P   0@ P@ЍP  rR 0rST 0 @0 Ѝ@zxY 0 x4 $4 DZ A-`@#p 0P/S /}UP @0p S 0 S ? PXp@-IMM@`PP p 0: S X0 0vp IލЍp'YO00@IލЍpY00/ p@-IMM@`PP p 0: S X0 0Kp IލЍpXO00@IލЍpX00Ё -M 0  PЍ P 80Q 0 08080//p@-@P P`P ѡ pPP u :JP  p@*EPPp-404-0 M  0 ЍЍ/$,P --M  Ѝ Ѝ// -@-MO<@@P 00  0Ѝ@Ѝ/,0-@- M@)OP  Ѝ@Ѝ/O-`Pq,Mp;  RP$  Ppp @P$wPX P@ @ 0 PX N ,Ѝ000:Q!0P00,Ѝ8p@-(M0P `& (Ѝp0 0 ,p@-@`PNpp p@808 0p@-(M0P `& (ЍpX,Hp@-P@0 @  0`Npp p@n,0@-,MP@Np  o&8 ^,Ѝ0Xp@-PP0 (M@ 0`lNp  W& F(Ѝpp,C-PP@,M@/ `  p`FV`R V `@0@ WT 8N7 ,Ѝ00 0:200,Ѝ8p@-(M0P ` & (Ѝp0 0 ,p@-@`PNpp p@808 0p@-(M0P `% (Ѝp,Hp@-P@0 @  0`Mpp p@zD,0@-,MP@Mp  %8 j,Ѝ0Xp@-PP0 (M@ 0`Mp  % R(Ѝp, P $ Q80 8@-M80@08 Ѝ880/LL0000 0<R 80880Ѝ/LhP/p@-@0@00S 000 Xp t PP `00B/L00p@yHP,x,H( 8( O-@PM3 00 P1E `:7 ?O0S0PSppp0 0CM Y 1AUU V00- Y^ 1AUU1 0`Fs R30< ppp0 0C, U 0U4 [ 2 0000i`K L 0Rs L 0 0 B0SH Lu0a Ѝ V00 0w `L 0 l0pHX20S) 0 B^ P 0 B`FV  BLuZ 0 BG  BL 0 = ~Ld 0 00S B 0' 0 "wЍ0S \EPE U_* 0 UL! 0 0 0,p@-@PBLpp p@0RS00 /H0H0p@-@  @P%Lpp p@\,40 Q00 0R00 /,p@-`@PLpT T   p@php@-P X @ 00`KpTT  p@p`,O-P!M o 1D`00 S,0H?@@Q^ L  10$+10[CPp `u,  PPDEQ|0Bp5 q@[0 S8 0?# R R!R@[u`  ,0 0 L00NC1000P,0@Ѝ _0 00z,D0D 0@-00 @T )AP80@080@-@P AP80@080-M0 Ѝ-M0 ЍO-PiMOȡ@̑Ёرt Qp`P  P?`K͌V P`?K͌U P ?F͌(Z P>F͌(Y P6>C͌ X PT>JB͌81S P$ >̌[ P=^B͌ 0`3@@@ 0S7800PH0`@P@P @P@Pp@pP@P@P@P(@P@PP@(P@Px@PP( @Q80 <0x100C00S000C(0h0P 0@pDP@ 0ApP? ,  ` 0Z`! 0j1 W40 0 0 0 ` V  ,0 ` V,0Z 0 ``dqYh  0 [ }Piߍ, 0!`0 1S ,00 0 ఑1S D 0|0 0?p00(,P࠳0A Q Q(`80 0@$4 [$  B `R6     @T  @T,0[  @,匠$ Z!@p,0P p W  `,0R4 @80\ 00 0 0R-@pP@ 1L00PPX1P PP00P0001T00P1 X000`P`(, A$48`@@D 0P0A 0HZMH0Uj0 @, P  X 0h1T1 P0 ` 0V0p00 `V0X,00 P `ܰA[@` @PP ` V @ T 0PZPD0U |Z 0$4,8`@@U 0 (P!  AA8@@$,4 Y-Tp0 p,`0 @@DH \V 0f1`Z1 @0 p P0U000 PU0V ,00 @ P尡XP 0@P P U `Z@@ DH @\p>\ ``,   , HH0X p0尡D0| 0 _>p[`p 00  0 ^ p 0 p`  0V  0` P  0U ` 0 P   0Z0^ύ P   0[0Jύ P   0X0̍ P   0Y0q΍ Pp   0W0( 0 $ B4U,8`@@ p`0, `$@  ,P0UH@少FʗD|=pTpYP$, `48@UpD0 0 0Rz 0St 0 P,00 8UK e 0PSa 0L000 @T @jT0 ,000 @(0P$ ` pC,U48@0 @,0@10 ,P0U 0H !Aʓ D  |4=p0 0Q1B?pPp@`P P @T  `Pp0(0S](0 00C00,Pp` V% 000 B!0 SB  0 T00 @T P@T0 ,P000 @0,,0Q0@ 0@1.0`` PPp@?P @T  p` P`p0SK 00  P,01U e!0PS:  P0 0 0 @ T @T0 ,00 0 @T!0R1VP@P0Px @U  0P0 0$4,8`@@0`$@(0 SX(0 @00C00, [$ 0 0 B 0!0@SC  0 X 0 0< P U  P;U0,00 0 P0|,0Q0P Pa}@0P  T  0 @5 0 0R}080000Sx$ `,48@f@dO-`YMq0tcSA P T3? 00K͌0 0u0S3?HPK͌0H0v0S2?p`F͌(0p0t0S{t2?@F͌(00w0So(2?pC͌ 00y0Sc1耍?B͌8 00{0SW1? ̌ 011s0SK1?81NB͌ 0810 @Yߍ 00u0Sl HPv0Sw p`t0S @w0S py0S 耍 {0S  1s0S N ķ8@-M@ @ 04@P$( ,Ѝ(,@-M@ @ 04@P$( ,eЍij,d0d 0 R/DHQ @Q$00?H/ဳ,x$X0P0/ D D  R #@ R 00?H/x$0P09 A-D   R'P?HU0`@S@T1,p10 0D C   S(  @T #@ R 00/ᘲx$0 00ꈱ,tP h H ?30 R - D#@ DR<0@ 0D//hx$O-P␲*!f><^v<;<p;0l 0 S/:G-MTȤPpk @+(@u($p T0CS0Sl3XPH$H :k{K[+; @0H`80@ &p % % % %!<%8!%,!#`!#"%("$%P"4%x",%"%" #~ $@!#!#!d""e"#-fh@#`"jlh# nkp{#rKt[v+x;z |:p R 0S (@0800S \ЍQ 82 0 0%D 'l J p@@\  0(PU(00Ѝ>A@J@ < ^v#x:'#0# 0H#p--`_|op~r{yxzu{r@|oh}lu+,-.`afghijklmnopqrstuvwxyz{|}<@ E , 0<$:l:<79A-'^X`` p@  @0\(`V(P7O-MP6 p6006006000Jҭ`∂0 0S00 U0Sp=0px @v   $ `00 4S 0 0 40 s0 0bR$ 4S4 0%00 Ѝ$0 s 00bR4S 0㋰ ?;21 R R2 $Ad r  `R$ $ Q 00%0  0U0pS0p @   $ `00 4S| 4 0 0  ;0w $Q B q/ 0 ; 0hpl4 S S04X0Sb 4 000r0  cR$HU p p p P pop P 44 $0$ s 00bR4d3 0 0gS D3051E `@ pS 3051E `1 p2 0 C0  ; 0 p [K40q0cR 4S0\20$0$ 0Cr?o  aR2$* p 0G% p 0$  0 s0 0bR40 ;0⻿p P< pI 40 s0 0bR4 4$R{ 4 00 0q0cR 40 s0 0bR41E00#?c pF0E00#?c p:`000! 006 4 00 40 s0 0bR 440`0035P@P@P@x@-@v@P `p@P >P10S. 0P:  0@S0S0[S0mS S@ 0S 1 CR'0@S ;S 00C S000@S0@S mS 0C ;S P  0@S;C o h ]O-P0M3@|2 PS 00@|2gЍ0 hD $@$ <% p 0$0(0FXd 4?P} Y -?P Z" &?Pp2?;~0p2x20P90l 0rr G"Rpp2ZP<3@|2Z >P|2?;~0|2V >P|28|21S0 4SOL%REYZG />3@B|2zZ[#ZXV-  >P(x28x2>3@|2`Y>0@p2~Z& ?C>3@|2)P RX,V  >Px2.#@|"8x2E>3@|2P :>3@|29 d x \  0 00[00- $ Tx Xl l  \pT 0t 0x|" Q܉5804  P X0 0//O- M\@0P`pT \2 !0S S0SXT Ѝ 0 O-M堑\ QЍⰏ |pPl0@P QR00  jP7 _ /0M CR0200ЍⰏpP00  D P  D 0P ;ర!+";`帰 就帱0 HH`P|@0 <00u2  D A-@P<Pp Pp@p `EPE`0 v2U @0 i 2@ p@-\`P@T 0S1 RT0S@@V0SQp@蠰G-l@`pS0 ST0S"Q0S 0ST0A-0M`@@ᛸP+ _ /0@M CS@j0 @ 0K~"  2 0QU x; P*#, _@Wۍྺ$1lP0 X - LM  R  ʂ0   Ѝ䘃X0 Q0L 00S P:@- 'o/40 0p@-P0S$ :@#RA# #p `0:#P#c B7'0:#!BA##p̂T0 P-0M 00S ʃ0  : Ѝ804  P T0 0//ᜁp@-P|``p@0@ )A0SP0P0:3S 8 L40 00 :#pLO- Mppl3 dS0`P\0 *`B'WX p p PT p   r  `R  00/"1 R# @0S S9 SW0C S p2051E `dpx  @U ` Ѝ R k  P   Ѝgp P ` Ѝ0 r 1 `R R   S7J @y  ` 0  S $q 1lR Q   Ѝ3p   B/oq"`Rm0E00#?c Ѝ 0T0 P00'0]4  ꨀ-- -,+*| )G-@P$S$3P`X 80$ RE T ʌ3S23SpkW " Rpw !8 {,Ѝ0w,0@-,MP@B5p  - j,Ѝ00@-,MP " _,Ѝ0-M 0  ЍT0P 0@-M0  0@, !  Ѝ v,t0t00@-@ P M@4p , 0 00 00P  fЍ0u,0@-M@P4p , 0 00 00P  MЍ0-M0 0,0 0  <Ѝ000 00:3S /tO-J03\ 4P"Xapp`1P 0pp1P=o6τ p_ͭ dc0 0#d#l`m0 F?2?Y 0pw2w ?0b2P`(0$ 300 0t`p@-D@D0@Ppp$ $0l m 0 pr`p@-@0@P:#Rx  ^d - # 0ppP`p-:pPr$dp@-@0@P :QpÓ\\p- #pp\P`p :q$dp@-@0@P:#Rx Ó \ "R-- , #pp2P`p:pp$0@p@-S@PP @p (0008 <@%8 ppHp,L0L 0@-@0:#R#R"#0:ol0l 0@-@ :QQ- :o0 0@-@ :QQ σ #ppPb :o0 0@-@ :QQ σ #ppP: :|n0 0p@-@P :QQ t Ã#ppgPp  :fpm0 0@-@ :QQ σ #pp?P` :Q$mp@-@0@P:#R  Pp @8 %8 "R--  #pp P`p:pp8 :|l$,@-<@<0@00:3S 0 0 k @-8@80@00:3S00|@k 0 0@-@:#R#R /` ppb`B" `"# P`P:#Rjp@-@0@P:#R#R! /@ ppb@Bh @  #vP`p:#Rp $jdp@-PPP. 0@` :QQ! “Tlƒt l pp#<P`p :QppHid0 00dh,0 00@h,@-@Z Mq`,pQ* c0 0 `00050 508003 Ѝ0 < 503 ЍL L0 0`0` Vj#cBP`h< 0 000:P/f 0 0@-00fT0T 00:3S 0 @-ppl.P`/fX0X 00 :3S 0- @-ppP`/$f$0$ 000:#Rs/e$0$ 000:#Ru/e00, 000:#Rs30/Pe(0( 000:#Ru30/e 0 000:/dp@-MP@0 PhD`000ssΧp 0Sx000 SC q R0 :#Ѝp R 00(00 3/Ѝpd,A-MQAP@0Sq QP 0S `\ 1 hDP00pp10p Q41 1`p0V0S  \100V0S  034pp- 03, pp/%ЍP  QÁP 0:Pl  ` A   0?90 0<800c|,L@-,@@0S800h@-$@@0S800(@-MP@@ 0S ЍP400   C80 0Ѝ 8@-Md@@ 0SЍ 8 0R  (00 Ѝ 8 H @-$M @00! 0@ @00@ .TP0 { p @` ֬P @PE0S 0  `PЍ` D P 00 C40Ѝ @0 N P0  0 /( 400 000S :P /TML0 H0 0S :-P /M400 000S :P /LL0 H0 0S :-P /pL400 000S :P /LH@- @@\ ʌP 0 @}K0 0@-0@T J 3$S B0pQ e7@.P ? @|K804 000S :P V/JX PT 00 R0S *P@04//J000 000S :P a/sW; 3$@PS2 SW)N0, S0s0 `SWP3PSSpP4Sbpp3PUp,0\4000?0C00401C0010L10|1spp@-@P X0P:"C0T0XppG- Ԁ\.P@p  `ᩪP LTL VW PT VW  H000S8 0Ꭺ0 0 CxO-(\ ?p`P`6PPP0 C CC/YP'P@@V OP P0` @ CP0 @ CX0埘!0`0SZ03@8 00a0`Bx0@-?0p   0 0X( `@B$ pP`@U  0000A8A-@PQP% pW0!  0S0>,<000 R   R   R  P '%4!`T `TX *P Q Sp QW02(Ap@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S -03@0SpX@ (@ 8Q0@0ppp@-@PTa`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  03@0S H000080S@08@0p4p=D0D 0 0S P@ ?# Q@080//d<,$0Q 00/<,$0Q 00y/;,L0L0p@-PR ` ?@gpp;,d0Q` 000S X@ (@ 8Q@@//H;,0 00:,0 001:,p@-P`0`0@T X0:20T1S@0?;@0M8000080S@08@0p:,P Q@0?30R@080//Rm/R/p@-@S `P?[ppRP X @0*8"@0 8 R #@( @ //P@/p: x0 0F  Q SC$ 0R U E(p$ 0*$` P0`00BTP @T 80@Tp` 0U,A-PP0P`00@Q0 0S: $0P pT00pW  0TP, 0S) 0@- \%@T \8x ƌ8 t ,0@0@PU 0P0U00 S0/0?o2?=X?A-P$@`V0S4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P 0 Q0@ B( `p0,0,0CA`1@ O0S( X8: 0@-BE? 080 P R00 8$P R  R0 00S00!R0$R0 R d1S0800800080$O-`QMRDp0[{PPv ሰ P,s P@0b W4) H0X?@S < ``@ `F0+; 008+;B H0|0$T`7 P \ l0 @8*BCЍ㌚P4, ƙP& :"R- 0 RH0SI 0p V0 0 @@  ʨOЍ #! PЍA-@PM,Q(PD Qp`AR   B P2 \/X* P%ʤ,@PP D00cD0C 0R p$`!b00P@0RЍPЍ0@-M@ 0 Ѝ@-M@ 0 Ѝ- M ЍO-Mȁ`@HP `JU@p_WNVPED 0    PI L1D00S*Y p$`(D0@p`0S00,0U00 D0@UpC0@aCY Ѝ00H00H0t  P PEP` V IIP ЍP @\x$0@-@P0M0 t l 0  B/o"  lPP ;Ѝ0PЍ0t,H@- @  0M0 KЍP-00 Q08SM$ 03ЍlP8 /-M 0  0N NLN ЍO-QPDM0@hlp0PtPx` RK TNP@[ B^@D࠳UEPpApWAA^@PU0EP pCpW[[3AP!p lp0@,00@0@0*l@ 0 @V 0 000@ X@* p0 Y DЍ  P Qp X@* 0Q0 00C0CO-, 0(0\ ,0!0s0 S ^LPNP0 (00S@P0 R] (0S&,(Ο 0L XΟP LT R8  , !B$  Q$  \(  r Q  , R(  0 ,!$ 4  R 80X@D0|c00 p 0SL01H@804 0,0000q,04 0Y 0Y 00S0` S0F0R8040,00p0y'09!IAYڸ@LH\R\ 0YpH0@\0S0000P P 00 SPR P)!R00S 00P ɟ`V0 0CS SppK 0 0S0 p @S P0P ` P R  0R  `T:,00Se@ Q0C0] 0 S00( 0S(00000 0 S(00 R0 000:3s T  T R 0` (`  R r@  t@T,0Q0@t@T80]P000S_8, 0@000h0S(00S80t00S. 80m 9m8, 0`V 00PP0 0C<0S} HDD0L  LL l<0L\mɟ`V?A80\T 0TD@00 R 0 R PP!YR   qY $Rf  0E0 0p^   0E  @000$R , 7@  e@000!Rp <w7 8000Vw00C000C0X6, 00S@0 5# X0:h2 , @6@Hf0` 08 0  4P, pu'00S  @Gp 1P11qWd5r`%`0 ;@00 00S 0 5# X0:h280V @ 03@0S 0S4, 0Q0A 00C0tp0 SPP 11 1R@pY{ RRQ^ 0    V#, R R   p6#`FpPC30`P@ !?3 pGWaFP `?0@0p00L0H0P 0P0P00` `0"P0T0<^L P0 R3(080 { 800  P, 020 $ p`lЍyP0080 80@080B0 R d1SlЍ( 0 0=pw \X1, p0, Q0A0`Ӊ8`! ,\PY @@PY :P0@, QcJ   8@,@ APX@T `P `pP@x 4 $4 8؄<hPT` P0 @ ` p, P@APUEDP P " Y   @@T`Q 0B0CPcP P8p0 CQQ @0p  0@4$<0S  P 0,0[1,01`w @@`[o P  XPj0$00S 0$ p0@X4<PLPA\P0(0 0S(0,0 ` p, Jz @W0,  \C `{80+0 @00C|(@ 0 080 b00Cy 0PXx  0Q04`000CP0 X0H080 0DP# @ \ 80@ 开J U0L J D |pPe d1Sb , 4@  TP:X X0P@ [@DT 0H H00HE@M00: 80 0R,`0A0X0000C 0@P `040 0E00` P0U U R R  X R RR*0SF 0 R@H7,  I@0 00p>@ ` `(0,0 000 0S 0 PC@08 U0 00P$b pQ_ R$R $Ry X  QCH5S@ `  9, @ 0  `n@ 00p0 `a00P u 0@`P 0 B00h 0 PD0 0p 0 P8+ 40U( R X R$R`V_ 0 0 0 x:, `@p@0` 0UH%RPR p RO $R $R X  Q R; L5S>  (;, `@ u0  `@ 00ph0 `00P  X0@`P 0 B00 K0 v  Q@  0`000 @000P  T P$ , <@ !0   @000P" , <0 0  0 A R! U =p, @@0 0p1S U h=, @`@0 0PL5S 0 0RU =p, @@0 0Lp0 0 0 7@000L, 4>@ 0  `C0` !@000tW 3  0 U@`; 0 0LP2Pj @00p U wʕH%Rl0 @@TI 0$ppP@<@U; <PP$p@`0` 0HRUnH50S0X0S*  0 0 00, @p@0` 0H6U~0 0 0 @000jP$pPaDhhyp@-@P`M`/ 0P0 R    80x  t000 000P 0  Ѝp80 @0 @'b000c``DЍp 0 00$,G-0M@PP  ",TX " \A` JPlppPd80 T0@000cp;`P`+``D0Ѝ0Ѝ@-@P @TO-PP ! 7 1D00S0H``?c`S., p !@G'T :#| 0cp @W0 S 8 0? P PP0 S  0 00, 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP @0 @T $0`U VP `Vp`^0P 0@PUpT` @ՊT @pp!` A!@-@P@T R/0A-p,SP` @T @媊T0`PS RQ A0@ ", "Q//@-`Q'pP@0D "! "T "! "U ^ 0N "! "\^pPV@@-@@@0S (0P0C(0i|O-M|:|z|*0p(P܂ pP L*40\b S @ s!@nRXl HR@ @i`80IS0c0@T ^OoB@TP AA  RR0)\ 4  |  bR\ P)` R&@) R! CP'I@0 8R S[80S  Y( 0P00B(0X @C0 8R CPf S ^\ `( 00Q @800 808,0RJ0H 0@0( (P)0S700S00l0S# 0 S 0 80R#0l 0 P0S  0P(0@P(H70 RЍ07 0, w(,04 SBG@ `a & ,04 S5(&0CP ,00xP0S (0P0C(0Il&@ : \&0 0@,@ R 50$600 80RpfF`@000 (P0 80@P0,@Sf 40 CRbڨ%% pp|% p%@ 4p,`Y r| `nR`F`V,00P0S  D( 0P00B(0X``!R  @ Q[Q $ 0,@  B0 00C S[ p@40084 0,0104#0zd4`000P ^% (@(#P@ ,@i4 Rv 0[, q  P+ p# l d# ,@(@?QW, 0 #\ (6 ,@  P Q0,@( R $@ P  @ lP " 1 200  0 m80 S -] *(D2 0( ܀(B@0S  ( 0P00B(0܀( 00P0 ! 뼱 40,`V7ڨA@ 10,`4 V0`Fx!,`0 xP0S I( 0P00B(00@'A@0S  6( 0P00B(0 0@||{`d{zP8z(zzyy(yyxxx$xwwTw@ww$uuuXuttsss($ssrprO-hs Md3p`C@4 P 8040800c`,0P Zn38@3`0T'#0CS 802PL좟 a0@DS,00S0 0l0S R "0 0A 208@0P0T0hP \RP4 @P 0, 0CS P 20 0 P1084 0, Ѝ04S00h0S40~1 0T4  @ P0P|@1,`0 R*T$ !P0 0 @T 0 R 0 P$ 0 0 00 lP @T000P0 0, p0  8@0SRC0PE@DP8@K 00SL008P괹0qqpdph8ppoDoXnHn4nm(@- 8 40,0m(@- 8 40,0Tm1!0O- @ M *BT8 h!O T!0 pR( X+ 0S#,PK U`0   R    PU0 PU0P0U0 S @T ЍpW,0P q`W0 P`00P0 [SV 0꘵0 00 08QD0S0l%R h%R /!R!RtP/P// 0 000 0P/PO- M똅P2 5` 80s5 t SD Pr T@R!1S<50 (5p0 P\`崦 50 00P 40 0400:@ p0 @ l%R h%R 0ʀl20 h"T0s# 20T0$,,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SO\Q*SvVrE Q SV_~V= Q SVWV5 Q SV@, Q SV# Q SV Q SVWV Q@S  ![=0Y2 0 C S@p"0TP!pR t0S8"R ,ŸU0 8@=0A00+ 1OaLOp`PU 0S 100S H0Z 0H0 , 0Q  ZQPU ЍZ 0   0 0 00R0 0 !R 0ʀl20 0 !R 0ʀl2%R t5S 0ʀl2Sr Sp Sn Sl Sj Sh SWehjhTgQfh1P0S\ PNPN D QG\E,@- 00ʃlœ\ 1:t“ '^ tƒ'΃r 'tƒr A\ B\ r^tƒ    //D[}=}1P0? 00` P9ʀ: l2'΀S00r200 /@ P 0000CS0 00000000000000000/ἫG|!|p@-P@M@(\\" rf Ptf vf0 P P 00 &000 0ЍpꌪhPd-X\\ rtv /0 0 t 00S `0008=0!@00 R/@-<pK``$$1 @-00*l"R @!@ R  (1:'.r"tB00 R @R   AR  ꘨J `_xx0 000:h/Lp@-`@M0@P0*l"R R &Ѝp   P 00 00@ 0 @ &Ѝp`   P H00 040@ 0 @ &ЍphT@2C-08R M0@PS "03@ @  "0S 1hp0&R  l"R R- ! f#@ @080@0 Ѝ1:'.QPs23Ml120l T10 0R0!Q:20h1:'.Q"s23020 00 010!Q:20t 00 0!0h0:0!Q 40-0!Q ]h0 000/ᨣ|0| 0p@-00@00C0S S p0 S P00'p|Pp0ꄣ0p@-0CS@0 S p0 S P00 p^Pp0000 0p@-00P&@p舢p@-P@p0 0 0S JQ R@-\,AQ /$,0P JP\@-\,AP /P/0S/ p@-b@ w$ x' ` B A x' +7JP@T`,PTa@@@PA w Rp03O-0`Pp$MCP@ W 峁P 0l#0C S-0 00$ЍT0 S80  2 0@t  B@DT p`$ЍIɟ,0P @I%!R1 Q0@Sf000(00^0Ŝ@$ @D DP[Z :0J@D U0 $0$0Z㰁? p@0`@`Pp ~P, P U   P`X0(P I0EXUP(E 0(0C\00C_$ЍY TPP  D0|0:p H0@D002 T `V `.V `` P|Dq q0 00l,p@-@Pppp@D0D0p@-@  @Pppp@$,O-@P-\60lM,0 j Q 0p噀`Pa P\~0P0[ W0  <0P 0R 080ЅP 0@SF0 0800`P0S 0P 0 0PEPUV 080 00PS0P<0>  ,500`0Pp0 @R  <0T R8 2 0<00800C?8080P`F2PY`00 ), t480 pP pK 0 `800`p8ppP P8 E0<,PpR%4\ Qձ(X  <R! p@p G"RX : HpG U  $ $ < S8 8 `<@(Pp4$0 ,0 1 D400pH0@0@0 0PU<$0 (Q0 0C0 St 0( 0C04 Q00SPz 80 0? ,0"8 P q0PI08p0 00i8 0k80pG0C?80n0P0C00S`FQd0pP0000C00P0 0PS8 0B! We 0 0pGH0㴢01 WD0|0p~lЍ#`Ꮗ& 0<0叇T R0<0 zPp 08k~lЍ`{x^~țmll0 0 WH,p@-@`Ppp p@I G0 0 0?,p@-@Ppp p@2Hp@-P@0 @  0`pp p@ꔔ,H0H0p@-@  @Ppp p@D,00@- 0Pp/ `00p@SL,0L .W @0*S /SR@@00@@@@0 00C@@0`` O-SMԑD@ HP 0U p` @ 0Z C 4/  Z: $Z <RH!  R! ".Q   R>- P   @0 0|00  GPr 00 R0S0 0?zP4/ZXЍ G\r 00 R0S@0p0]pP4/pWܒc$cQ# @-@M R ! R "R pP^  0 0@`Ѝ/@-0QM   S S PpP$@8R @ 6ЍH40@- M@ @#ЍtGH0DD @-M@ @Ѝ`$Gp@-0@R P\RP ^R3 @%` ,R'R{ LR @Qa0 L !a}0 p  % <{ R`VA 0 FR8h!@P`  Q ^0@! {cRE0'  p @m%X {m\R:R `O-$M`E zz@PP 0@%pp 0 ;S p< @`\p,S0 T 0@ @0 C00  S  Qu%S+0@GS0  iP%@0@@0 `fv` 00S1.Q0*Q  0S@0 SH^0 @0%0dP% @ 00@  d 0 S-`30 @0|0 0BB   0 0p<@0D0@00 S_S{- 00P$Ѝ0 S0^0@%  0 @  %#  0 S^0p0p0 %0 0[0@%+@%#F0 0@`0 S00 @s0p 00pp  00 p   0000!010 @0r 0 p       Tp0 S\R W' I00 S{0$, m/ 0 s0`f  Sv` 0S0\S 0 S]00 C00]@\ZZp@-@PM0P`0S SP!  0 00Pl 0 Q00Q H  < x0 Ѝp0x4> >=l=O-M0@DS@!00@0p0S= Q0 N[AK ` 9 8 g=M%㕞R ᫱nੑ)bP P  02#cQ+0P pW$P@PW 0fSPЍЍ 0Ѝ者WG-M0@HSD!00@0p0SD CPq0 ` k@ 3㞜>C l.b  ! ƒ120BQ0P pW$P@PT 0nSPЍ0"ЍЍ,VO-M0PS!0 0  0000SW @har*sE 0 `Ə⊡ - ?D%ᜲ✳B.b CĠ C,ᜁa b ! 2ਁሂB?PF @G$SP (0  #(0-( ?,D*Ec,`% f`Co1c,A ,0$0b  0Ã#3#cQ P $0tS P@ 0cS0dPSP ` P0H P[w00|RlxjO4O| A-pP`0\ %\0@pS sS lS P0\UUW 000@1CP0PCV`1E !00O-PQsM<00 P` 00S040 P t@   AH &Y 1   RSI X P  4  PX %X%X ,  R:@vP 400@, %0404@p;l[` @0P`@ p0 :XBX HQ  0H  P0 P`500>X A0Hs =R* =S00 C?Q^` V`1 PQ -^. 0XXC cHqQ  ^`z PA0H^l ` Y PA0Ha0Hs Rm11OSp00sߍxI@[-JuP 00040AuP, 000!^` P`1l X   QU PEQQ$Q V! 3`,  RP*P  0ᲆp 40P040 P PP`1  ]1S@ 0C11$1S= X! H0 Cr 2 'X POQ0$S'St! 0S'S'SX AT 0D1S1$a @D`7&HAq0 $VX฀ `OTb 011$a t!AT @DAA$Aa0Hs RA0HS3HAڕ0     00C2"0OQ60}SS$! t! 0S}S}SP1SZ !0C1pqWu j#P1`,Q*P  0pb 40040k10Hs Rf1tx1OS!P$!01tWAT @DA`1$P 5OT1a$010$1A0St00t00S|00|050S%   ?R ;R P0S %S0 01S. 0C11$AT+ #,Q,*P  4 @ , 40, P 0P`1GA0HS30H1OS!0$t1?00@1@`tPz 400`,Vp p2tPo 400p,"000S   ?R ;RO eRQg P0S %S0 0AT @DA1 $OTC0 $01@At!`V ᫣```&``VP``P``ù`@oobP``V ``@Q AIQ AAT6 @D!XA1 $oV 2EtP 400,PV`00`00 1&H 0 GX @pq0000y!Ho0㨂00~00)y000uV@p``P`V@p`K@`fpG@opC`@p?oo@pb:z$a`4/]X- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/lA-PQMp@ 0S XA ssP !P` v00) V T{ 00 PPT00e 00ЍT ȯB 0 0 R T| ຯTdയP0S T`, य hDip 0S R s0r (0 000ST00P b  p0(0wP b  p00PjT<d0`Ƚ |  D ܾ 0R@-M  H@P Ѝ0A-pPzP U) @T`0DV 0PS |@PV  ,P $oA-PR pQ &00 @`R P0 C C0CP P (&0 ES  rP  0 000Q 0  R0 R   Q PAuPP0V Q \`Q  0S  0 S o W0C s0 _S0S  0 S  RQV0C s0SPUD P 0$XFPF "J X$@ 9 02 0nP; sPG fPV P00?oR20S   qQ :%qP N@!qPJ9qPL2$ PP wr$Psr qP$!W P P  ?o2?    0SP V PC-@|QMx!pP `0X P 000S8 @ЍYPP p 0 p R 0S 0P@ P@ @Ѝ 0 jP LP+P P *PP004ظ O-M Mp0:S(0S:S@ 0PS:S``!E PXP  0 ` jP 0P:S  ۍ Ѝ@ ۍ ЍŸC-PM M@p`tQP2 0/SB P JqY PD 4P 0 ۍЍC\(0P L!  P4,0P 0S/S ؟pP UqX0 ۍЍC0  PۍЍ p 03q XW P0L 0 $ۍЍ404 0 $d< ĵ X  dT G-p`@P  _PqU  VP `P@PP @ PT   0!G`LL-@- M@00 Ѝ@ Ѝ/xA Ѝ@ Ѝ/@-@ppp@pp p0p@ g 0p@-PS@:pS pP!po @-Q @TnR  sR' fR Q P R\  Q Y 0 ^Q  R Q A- @X p`fS@X PL0@P0@nS sS@X@@  0 0S00@PA-P% Ppp R,R    0S,S@Bn`P   `00pp@ d G-pT@`P P4npWW*nU< sUZ fUH0D Y+R. @ WoP" H0D@p H0@0H0H0nUp@0 H PL sU: fU& L00L0@ ]P @P 1n 0S0000W 0 0H0@ H00 ,00H0@, ( H0@0H0hH0, 0H0 @ QH0 $H00H0$PH00H0| O-M Y pP pX` `0( 8H0 m0P@^ P  Yp  X`   R , R < R! L R* JЍ`P    , R `P    < R `P 0   L R `P 0@0  1!00@- 0 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S00lWA-`0p @PPUR mP!0 V0 00pp   0  0 0PlO-P@0 $M 0'P `\n`Z4 p p  m0P   0" An `| @P  @m0P -n $Ѝ 0 "n n,` $0V p C, # @ 0 S00rPb `V X  @R`V  @R`V @TRmL`0D V@@0BL07 pfS&p @P" `V!  @0nS sSpXpp@@ p0 0 m $Ѝ j[f[@p8  A-P0p @``VR! lPA0 `0 00P 000Xf[`FPk0A-P p@`WR lP0 ` 00P 00 0PkO-LM<0< 0*0, 0, TpP |,|@P00`P  00_PmT P ?PkPMlPP p pP V 0 T 0,P`4 0 ` 10#s0$090400S% $ .S  ROS> =pP 00p`v= <00P5 P 00 R,P `lLЍ#d@P= pp`v ,0 S Q0S Q0TS 0 x000 00 0( P-Z80k80 R(lPLЍ@0@S@ p@t`00 000 000f0[PYd (@[  [0pP ;  )\[  R-Y %\^[\= @[0P00GS(v  0P (Z0 KrQ40E K/RN  [@ [(&,0  @ 00@%,0  H p00 DZD00S P  Pf 0 b 0SJ v 0c 0  00 0000n0g p( 5k807` Q  Q 0S00  p    00 ?[/v 0 S00P0@ P  0BPx,  d0 80z Y80 [!0@B PT@@p/ 0 0 000s02P (j@p@tnp@t: ,0 Sc Q0S \ QO_PaT` P(0  *00 #(3{P00qPp@t0y <00QF Q 0A R0  P0 0bPB0 0 0 0S00P- ,pr0  "< y0 000P $ pP8PY 8 x 4 P/$P0 00 //OA-M`0 KpH gMM%PN  1N;A\㓌al1#b 0 0#@B4d!@PЍhO P0`0>//N@-MP0 C`CNC k,'@`0|0~Pl n "020#AB@C1d PЍN1P00&>//NA-M@p0 sb*cEQ  - ?D0垂|垃B p@LLD&$b@C >c 000@d$C4d1PЍmMp@-0M`P02@P 0Ѝp\0 0  B0S Q20ЍpTc1!0G-@Pq0P04 0 `4 `S002,0PP00|``Q  VPe`EȄQ  V|0`0ȇ`H00@BlL@-@P \iZiXi Vi$Ti,RiPi,00!R  !  001/001P// @--`@@X0@00s@ H PJI HH @@Lp@- @-D@4(M@0 `PR  U a  !00 (ЍpP  P # U0  0c 0U^!00 P ~Pn H# U0 0 0"]P 0S= !00 cP00G200U 0 DP 0Sb !00 cP00>ʀ20U 0+?"7D7L"'PF  cP00b,20U 0S 0"P 0S Y!00 cP00LU 0 " P  qcP00Sʈ10U 0 !6"?7D"%JP  YcP00,U 0 " KcP0000U 0"?7L"P 90S !00 1cP00ʔ00U 0"?7L"P 0S !00  ,@L`T , < Ԓ ȑ | 4 ܏ d  l h Ѝ x  X x cP00h00U 0"?7L"iP 0S !00 cP0000U 0; 0"PP 0S !00 cP00M,10 00 ?G?OU" 3PC  cP00:ʀ100U 0 !P 0S e!00 cP00100U 0 P ~0S L!00 vcP00'@20U 0"?7L"P d0S0 2!00 \cP00ʤ20U 0"?7D"P  IcP00{20U 0k"?7L"P 70S8 !00 /cP00P30U 0"?7D"P  cP00ʘ300U 0 B P  0Sd !00 cP009300U 0 T ~P 0S !00 cP00P40U 0"?7L"dP 0S) !00 cP00ʴ40uU 0y LP  cP0040U 0"?7D"9P 0S }!00 cP00X50U 0"?7L"P 0Sj c!00 cP00jʼ50U 0Z"?7D"P8  zcP0060U 0"?7D"P  gcP00wL60U 00" P V0S $"00 NcP00.ʬ60U 00"_ P =0S "00 5cP00 70*0 0Ra U  P  cP00p30U 0"?7L"P 0S !00 cP00$ 30U 0"?7L"~P 0S !00 cP00Nʨ20U 0>"?7L"dP 0S !00 cP00D20U 0"?7D"JP  cP0010U 00" 8P 0S |"00 cP00 ʜ10U 00" P 0S c"00 cP00<100U 0!   P |0S J!00 tcP0000U 0"?7D"P b0S 0!00 ZcP00 p000U 0` P H0S !00 @l  | Ȉ ć x < l P x  @ \ 4 4 Ȃ | l $ ā X T P    |  p x  h 0  ~ ~ H~ } ~ ~ cP00w00U 0g"?7L"|P 0S !00 cP00t@U 0 "% cP  cP00\ʄ10U 00"  QP 0S "00 cP00Z10U 0J"?7L"7P 0S {!00 cP00H20U 00" P 0SE b"00 P 0S U!00 200?G?OU "E"00 o303030U 0?G"1"00 [L30T30>U 0?O" "00 J30U 0?G""00 <300UT!00 /30E30\U 0?G""00 (40040U 0?O"!00 d40U 0?G">"00 40/40?U 0?O"X!00 40I40U 0?O"!00 5050 50JU 0?O"!00 T50\50U 0?G"!00 50U 0?G"A"00 50250tU 0?O"o!00 6060U 0?O"^"00 <60U 0?G"P!00 zp60x606060U 0?O"6!00 `600U&!00 P60U 0?O"""00 B0700U !00 5`70h 0?G"ZI [I 0 ?O"U"00 700U,!00 700U+!00 (80\"00 "00 X( `( A : PI S @ "00 "00 !00 !00 !00 "00 "00 !00 "00 "00 "00 z!00 s!00 n"00 P  H 0?G"IP !H H 0 ?O"0SL!00 v" |" A"00 k<"00 f7"00 a2"00 \-"00 W("00 R#"00 M"00 H"00 C"00 >"00 9I lI "?7L"|1 00X1 0041 @@F0 e1 00+0 @@0X0 60 800-DT! @D| | <| { } { | @{ z { { { y z pz (z z lz Py y y y w w w w Px x x x w v w ,w 0 |00d40 00?X0 00y8!00 0 00k0 00b0 000Y0 P00P 1 p00GD1 @@0 :x1 @@0 -+1 00$&1 0071 0002 @@s`0 L2 00Cp2 002 00K2 00o2 00M3 @@900 q43 P00NX3 p00|3 003 003 00R3 00!00  -Q*Ϡ?B0CSS*/ @RR#  S Q0 +C 0` 03S S 0A.B0 B33200P10+SQnD {ȠȠ 00+C w{0 +S0+CA@/ /P 0S $0S 0S P? @4@P//A-0Pp`8P' , R( 0"0, 4000R40G@BT@! V @D8 ,0400G ,0 4 00( @(4/P8,0S0Q 400 @-P00>  4O R 0 S. o+7N<$PI@'Np LA 0P R $ R  R S /0?0P  ,AA40q@aR 4 8S1R  .PA-@ 0` S ($ R +3/PP P4?p@8p0P$0(3/p8  $ ,  (0 0/X0 P 0S $0S 0S P? @4@P/Q Q@ \@!< < /<0C//?O- 00Q?0$0SW$ 0  0p6?@0U 0PEt@T$0Sp0  0@7?p0U 0PEt@T$0Sw  '$   0   0s 0 8$ @pRyp=?0Uq 0PEt@T7p0pp@>?00S; D??0000CSU0S8 0@7sN?0 QP?0F(0 S@p0(00 ;?O35?0U/ 0PEt@Tw0pS ,<00Q?0LQdD0*;J?0\0T  0T :$0PEt@ 0SU0P`0,P 0U 0@@P7s@D;D D 0;??0:hq Tn Xl j `j h 0pf c hb _ U F $0 S P D0 S2D57[U0  0  ; [PE`0 粰\ 0>* @7s@D 000Q?0*P;X00T :D0PEt@0S;UR?0\ \ ^kPEt@^eU@pj $0Ë 0P( $, 0PEt@< 0QoU(2D?q@D0D 0B # @'8w<#0#[" 200Q?0h0q @DS30P0;T0X0CG?0W K?HL0[  30'0DSB?0 @p7s0D@C s PQl0~90r0\l^PEt@^U2q@D00Q?0 ,( 粰* @D7p*R !B"0$ S 0l0S>/0p0P0X0Xt  0p0P 200Q?0 +@} 100Q?0 7?Rd0@p00 0p!100Q?0E?l 0a^gPEt@Ta*U 0@0Sa 0 000+QO?0 0S 0@p0,> \, PEt@ 0\BUԂr7s0D@Cq- (^ ^ X'^ P^ \ Z hZ [ Y I?L09O?00 s0P7s@Da 0@D'q'0@ph0dlF?0 Ԃ7s˂PD 0D@C7q  0`P 000/ S   P00S  5 20S R?0P 0S $0S 0S P ?,B4 BR/  $0 /,#,3 C- M0P000@P`^0@\ S?R 0 <032   A0Q#4<0M0@0 Q Q0c  B\Q~ S Qt 0 S?Rt @0 <0@\32<0p0l0^ppWo H Q0c  R#2Q S Q0 S R*0Q  R*0Q  R:0l00p0C0l0pSp1x 000 08P,0C4p??0 0 0 0 30 Ѝ0SypSpl0Spp l0@@@ 긅HP 0S $0S 0S P?,A4 BR/A/Q /@o/A-Xy@ 0(+p3/PPv 8`VG (0 ( 03/`P0 0d @ 0T   +P 45R*p 0 B0p0(0 8#8`Po RS> B0V P T  B T p  B0p0`0 0@ 0T   +P 45R:o Rp 0` B0p0$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-R|MP  80 @ 0 C 0T0X0ps\pW0- p p0 |Ѝ0`^`V0P@0t;JUS1@Z0@P05ᲀ0 Ts00R 0x@S0BSC@ RUP!U0!01P 0020# P0S|Ѝ0W0P0S |Ѝ0@ ?o2,0%R00(0S2( 0 0@0$0 0( $0,0  00 B0 4 p@ 0RPRN ࠃ0`PPҗ$ <: 80C1 ( RP@00F#3 0S# Br #RVE  ` R*  ^ F C 0 Z( V F( *FQ* BR  ( Q  Rf, %Q  R`0!LAS4 @@  0010,0!(0 , 0 $0`O-04M0C000 C BP [P1: bp Wۄ2  B37Ro @gqq`36 B p`Wl B37`@^`pNV*jkV`H$Va `\``\pWL\`pNWNWN\ \  ?QPK@ U2E@ AaPA0% 2@  `"<0@ 4Ѝ`p 0@ Q2W ۅ >`V7*pG(p\ p`$p`p`p($p$p@ V(`$p PI:`@`L\p``^`@`^`@\+ \#$\```a$(@$,$ V,(`@O Ql$(@$,$ V`G(0L`$`0``$0P\(0`@(80H G F LD, -0qR0Cs\@0qR0CsPO-,P$Ml0AOEx@D8SAO<@0@D000@^0| 0S`"!!Pt0@p^4! 0TT* RR 0 P ^ ^ ^YY 0 PU<PU=PU>PU?PU@PUA0PUAPR@oPP 0C 02#03/0@SPn Pf Wo0S S00\0 00#400 03 0  0#400  0 c0S0c0?o20 Ѝ0Sy<00000! S *SL0Sq00Q R0@SP Wg Wu10S0(0 Ѝ0 0S&+Bql0S0 B8@ B0 #22c0# 0l0Sb q000 R09S ES IS [SD gS0, q0S0+W  2R-C0Q` ! 0P B X:G PE [ P ! X8*H 0 ,0 SR B000SS@ ӇS  00 # #8 00#"0  o0 ,  Q R I   R&   0P P0S00  P,0SQ:_ R,0, R  R [  $ R  $ 0P P0S00  P,0SQ:3 R0 c0 0t0 0  R ,00SP0^01$ ^U0 R1 200 00 0#400 00 00 S0 S 00R01 00 00 R  00 0#400, R E  P20 u0 B00>0 B00cR5 0 00c,0S+  Rg00 0 B000, g00R  0Qu RC00 00#400q00]0S+Zt 6l8&`6 &!6ƅ909&tl0QIt0l0" Yt0SW :W㴖s 6S \0l S B8 0 l0\000S\ R8 C0r l0\000S0Zt0(l 8`R B  ^E 6&!6ƅ6ƅ909&6Rt0l 0Ct0 l S3t0 SW S Sl 8`0 Z W 0S0^0 B000R ^ ^  [ [ [ [ [ [ [ KPo᫲[@ ``S`051:P&0@ƅs0,!ƅ0 0!1001  &6`Rt0l 0C` t0l x\0S B80 l0\0:00S;#  #800#"0  0 0 0 0 0 S0 S 00R01 q00  R000 000**W6: &R \ R80l0 C  B0 00BL0D!C0C  Vt0S*l0\06~\0l S B8 0 l0\000S20k\ R80l0 C   A-`pPSq@PB Q00V0SH0S: (0sU Q P10 00000 |0 `hp' 0S)t l00\ R#6S S L0D C0 C060P@0 05 1# 0Rppꄦp@-@0PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV00PpPO-M`pH0S@DL 08Q1S00PP 0 0S $0Sx wpVoV`F0HSx0FSRt WrZpFYo᫲[iV @(& `4/@Pn * *J@0`PA,*` 4`L  L   ` B (6/ `, 8(6/ `L @(6/j 0 D(3/80S6! ( @ R% D PR! 00C60p删$0ЍOxv `fh00$0X(0 xЍ",0  000!̷-M 0 @ЍA-P?Un`0 0@ 0Q@   & 0(3/@PR &@z 0, (P3/ 0, 8(3/ 0L @(3/ 0 D(3/08P. @ R+ D SR% , 8 , @@ L DD &!0 0C&006 0&;> 0$0;/ O-Q$M R0 x 0S!q"$!`Lß@P p`0+0*) `@$z0`&@!y0v0 qp0Pt0A1:SuPPQ "9SuPQ(6SuPQp'P5S>3uPs01+@$ "@QP`0.(Ÿ  "rQ"$ Ÿ! ! q R!   "  "rQ"$  ++ { R+! @$ $rQ"$ S4XP `QPE@QU`&Qv`a"$&@$t@a @Q"d& Q p& "r a Q d& Q@$t@A&D$ pa Q$d& "r A&D$ p!$$"C0S 0!^q"$!$Ѝ LÁ!`Q1c0@pu  p D  C-`R@p S]N `  1!"\ C 0  .`  N1@"T C 0    C-`R@p S]N `  1!"\ C 0  .`  N1@"T C 0   ( @-PP |p CMNp`P`  1!Ē"Q C 0  P`T @-PP |p CMNp`P`  1!Ē"Q C 0  P` 0@-1 S]N,^@C 0   0RG- pe Q RLuRnq@W-@He_V @0@0\\ 0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 R 0ɃP 7ᕓi΃7nP"R 0Q ?Yq00H/II7c ? Y?II^NNPV=H10C=@L   0R `R 0PR`RP0`R0`PR0P`R0`PR0P`R0`PR0P`R0`PR0P`R0`PR0P`R0`PR0RP0 00@  0C 00 Q q00H 'ᑒi7n00R#@-qHp@#/ǠCPQ- ONւp0S P40@0P401pB RP$R&ʵςvp X`^0 `1`P$[0ఐ`G6f0C6R`0p   _pWPQ=000?10 J`P02  `;JTt`;!G XTT;岰!0 X0P0~p&0v00 0`k`$ZP`+G 0p 0⳾ `L 0L0 F0 < pR@ 0 q0CR =Y> 0 BV0 00000C00 `FR 0@N @0 0P000SQ R 0@B0 R 00QDЍP  =p`w\ / !02NX1@[ @೰6:#6\Y I0 0O-@Ⲁ MAX``PPR ಐs@D+~@ p+0  RlX+ Y|   ^  DT0V `P \( RP|\ P`PP8 TA ` 0P X 7  Rʰ ^ T0. `P\ T0$  ^ T0 `P ^T0 `P T 0 P XР Ѝ  O-$MⲰ[PPR|1Z@+8+00+0`0* X [Pv S ~:|:0nSWuPT0N`PppPP`pp.pn\Πv|P::0lSWuP0L`PppPP0`pp#40060c^~P H\xƂ0̅|PP0PP#4 0ƒ0lLXxP0QPƃ9 Q0T pQ `k^⧎P p@6a pA S#0r 0   0#406 c0TBt `V 6 pW @0S p`W0\  P`Q U0p XF+=00c^0~ P0CppP .pp 0n\Π| S6`FPQ3ps00p00Ppp#406c 0CVn`6D0Th pW `k007PlUs0PL 0pp00P #4pp0060c^~0 \ƂR `FPQ̃6p|pPpp,Ġƒl LVn`Ƃ 0T# pQ(0 S P `a\uP p 0\0 `W5 p 0 S$Ѝ0pvH Qx066㳀 H Qx6Ƃ峀v P `'0 S P `0 S  P`0@\ 0V p` 0 @`NʀO-M6S 3k^P003`0030 0300300A @b9 Ts0@ Bp000@p#406 0c^&6S6 ⼖@ `0$0 p฀n9 Zs0 N0 00#4 060cXx0qX xq@DphWt@>挥s0pH000p#4060cTCt0 BR@@@CAԕBԅApಀphY>s0H000#4060cWsw0 p0@sW hD B@gTr >s0=pG@000@#406p0cR#6 SveF&0PnR2s0 NP0``00 @#4PP0&0b Qq0&0Ѝ 0&;p0v7 0G0@-0J ; &̀+ V(08;0,+ $ˀ 0 &)0S0 0xS0 0LS4j>0C&&0A-@ s0`P Q!r  pp "$  a AS2s 6 u u0U0U$0Q  00  0 000*0@-6S S0ظ0@@6 0C606@PP@@!PPƂ0*0@-6 S0q0@PP0#4@@06c 0C\| S600@PP0@@@#406 0CS6 S0ظ0@@6 0C606@PP@@!PPƂ0O-Q0  MR@T, R 0p#&]P+}(+z0O p ! R<AQ j  &!R*\ R3 "[(&0 Z)p:s00 00 "$ 缦0j JP3s0 Z㼦,N(r :s0s00 00#40缦0j JR#r0{ Z㼦:s0s00 00#40缦0j JR3s0 A Z㼦r :s s00 00#40缦0j JR#r 0ßk>0 NΌ⼦  Z*r   "$ 缦 j JPp Q ἦ ? <  K O  \ P+R +R ,RE R  Q ,P3 "[Z6 Sap3 s0000 #406 c 0CPp P66 O.V G.0 0S0 0xS0  0LS4j>X0C&&  Ѝ &]R3 "[jP ЍOb Pj 0 r :s0q#0r H :Q0@-!DƓPV ƓPV @Ɠ@F !6@o0ƓAQDƃ<  Ì!!ܕ"܅  , 0S A-@P p0 C`\0VUV `&P %/@- M`@p*PP P#  Z0 `p : @P Ѝv @@ Ѝp@@l@:T  Ѝp@-P)@P @000pW 00p@-@)0P 0000F 00Cp@-MP`)@P P @ϻ 000p R:PЍp(PJ:U "PЍp0A-S ` @p0 C@P/U  0 &y1r1FPP`%0A-S ` @p0 CP/U 0 %t3i4FPP<%0S A- p@P0 C`{/V `/0S A- `@p0 CPa/U %y1r1FPP%/0S A- `@p0 CP?/U %t3i4FPP$/0@- M@ H/p  P Ѝ0h Ѝ0d0 Ѝ00@- M@ //p y!r!F P Ѝ0N Ѝ0J0 Ѝ00@- M@ /p t#i$F P Ѝ04 Ѝ000 Ѝ0- M Ѝ- MtiF Ѝp@-@fP2%t3i4FPPpp@-@ZP&%l?o2FP pP00pp@-P`@PP  PU$p@-@8@ @-@2@ @-@,@ @-@&@ @-@ @1 @-@@A @-@@^ @-@@w @-@@ @-@@ @-@@ @-@@ @-@@ @-@@@-@@@-@@.@-@@F@-@@]@-@@t@-@@p@-P` @PP  P#pp@-P` @PP  P#pp@-P`s @PP  P#pp@-P`a @PP  P#pp@-P`0PM @PP  P#pp@-P`; @PP  Po#pp@-P`) @PP  P]#pp@-P` @PP  PK#pp@-P` @PP  P9#pp@-P`0P @PP  oP%#pp@-P` @PP  ]P#pp@-P` @PP  KP#pp@-P` @PP  9P"pp@-P` @PP  'P"pp@-P`0P @PP  P"pp@-P` @PP  P"pp@-P` @PP  P"pp@-P`u @PP  P"pp@-P`c @PP  P"pp@-P`0PO @PP  Pm"pp@-PP@#g>t3GP p?0P 0pp@-P`@PP  PJ"pp@-P`@PP  P9"pp@-`P@"aaFP pP U ypp@-P`@PP  YP"pp@-P`)@PP  GP!pA-P@"g>t3GP p#5`P  P `6p@-P@"g>t3GP p0P 0pp@-P`>@PP  P!pp@-P`2@PP  P!pp@-@RP P!pp@-@t PP"l?o2FP pz00pp@-P`@@PP   P!pp@-P0@PP  Pp!p@-@C @ @-@= @ @-@7 @ @-@1 @/ @-@+ @L @-@% @\ @-@ @y @-@ @ @-@ @ @-@ @ @-@ @ @-@ @ @-@@ @-@@ @-@@6 @-@@I @-@@a @-@@x @-@@ @-@@ p@-P`@PP  P p0p@-P@PP " P pp@-P`@PP  P p0p@-P}@PP P pp@-P`l@PP  P p0p@-PZ@PP P pp@-P`I@PP  P} p0p@-P7@PP Pl pp@-P`0P$@PP  \PX pp@-P0P@PP PF pp@-P`@PP  8P4 p0p@-P@PP pP# pp@-P`@PP  P p0p@-P@PP MP pp@-P`@PP  Pp0p@-P@PP *Ppp@-P`@PP  Pp0p@-P@PP Ppp@-P`0Pr@PP  Ppp@-P0P_@PP Ppp@-P`d@PP  Pp p@-PR@PP Pqpp@-P`A@PP  cP_p p@-P/@PP PNpp@-P`@PP  @P<p p@-P @PP xP+pp@-P`@PP  Pp p@-P@PP UPpp@-P`0P@PP  Ppp@-P0P@PP /Ppp@-P`@PP  Pp p@-P@PP  Ppp@-P`@PP  Pp p@-P}@PP Ppp@-P`l@PP  Pp p@-PZ@PP Pypp@-P`I@PP  kPgp p@-P7@PP PVpp@-P`0P$@PP  FPBpp@-P0P@PP }P0pp@-P@g>t3GP p0P 0pp@-P`@PP  P pp@-P@PP KPpp@-P`t@PP  Ppp@-Pd@PP +Ppp@-`P@aaFP p0P U pp@-P`@PP  Ppp@-P`@PP  Ppp@-P @PP Ppp@-P @PP PpA-PS@/g>t3GP Gp0`P  ^P `"2p@-P5@g>t3GP p40P 0pp@-P`@PP  CP?pp@-P@PP }P0pp@-P`@PP  #Ppp@-P@PP ]Ppp@-@QP SPpp@-@RP Ppp@-@0 P 11p@PP"0S "p֮~"0@- @@e"խ<OP 0R @-P Q ro//  P ^0t 0 @-8< X@-P Q @I@ f<0< 0 ( g$0$ 0  4Ȭ 8ܼ 0S p@- X@P`@@0PpsP p@l lN$NA-P`p" /@P  7P` pp!ᠭP` *!U @0!00Mp@-P @`Pp P p@@- D/@P $ 0 0 0 LA-pP 1/@P"  0 0 0 P /`P  Ⴗ` P0 /,0, 0< ?@xL 0@-@P @ h }0 0X %봩 Lȹ-A-M `V $P 0Pq@@P.pP  0Pe@ ?ЍAЍ/ЍAЍ/ U0 0t  Ա@-@P @  }0 0X ٵ넨 p@-@P x0 0 0R0 P.0P Q # p@App@JXp@-@P `0 0 0R Pt.0P Q w# p@pIP/0 0 0R /4IP/<0 0 0R0/P///Id@-P d0o0 0QP  00SQ 2#HP/0 0 0R/4H@-@P \0 0 0R   .0P Q  #00H4P/00 0 0RP///GA-PPM 0/o0" 0P R Ѝ R0 p 0 p-`P 0 S  R @  U?`P ;/  008GA-@PM 0 0 0R ЍQP 0 ፰ 0p-`P 0S ` P ?`P /000( ;$0$ 0 ࠴DF0 ` P H0-0/o 0"^ R  RG/TEP/D0 0 0R /@-P oDDP/D0 0 0R /@-P oDP t0/o0" 0\ R RP Q $Qf O/-۩W@, M(0( 0 Ҳ ? ̭ 00 S 0 P :\03#/S 0 P \0///-M 0  Ѝ-M 0  {Ѝ0@-M@P0  @0nЍ00@-M@P0  @0aЍ0@-@P ,0 0 0R= /P/0 0 0R / 00 !S R!* R0*/ - ^0 : 0P0*  R*/@@/ / <P $0 0 0R //;P $0 0 0R //;P $0 0 0R //\;P $0 0 0R //$;P/h0 0 0R / 00 !R0* /  P 5*/:P/h0 0 0R / 00 ! R0* /  P 1*/p:P/x0 0 0R / 00 !R0* /  -^ :9P/x0 0 0R / 00 !R0* /  -^ :h9P/D0 0 0R / 0 S0/8P/x0 0 0R / 00 !R0* /  -^ :8P/h0 0 0R / 00 !R0* /  P 5*/7P/h0 0 0R / 00 ! R0* /  P 1*/|7P/x0 0 0R / 00 !R0* /  -^ :7P/D0 0 0R / 0 S0/t6P/`0 0 0R / 00 ! R0* /  \ 5*/6P/`0 0 0R / 00 !R0* / \ 1*/5P/d0 0 0R / 00 !S/ / P %:/45P/d0 0 0R / 00 !S/ / P %:/4P/P0 0 0R / 00 R/! /D4P/d0 0 0R / 00 !S/ / P %:/3P/`0 0 0R / 00 ! R0* /  \ 5*/h3P/`0 0 0R / 00 !R0* / \ 1*/2P/d0 0 0R / 00 !S/ / P %:/2P/P0 0 0R / 00 R/! /2 P H0-0/o 0"^ R  RK/1P/L \ /  JQ\/H1P/L \ /  JQ\/0P/P \ / Q/S/Q\/0P/P \ / Q/S/Q\/$00PSC-M`p pP F Ѝ(@YP+ A' 0Q xRH 8 j0Ps%* 0 000S  P Ѝ I0Ps: 0"S0"S  qp   0 00S  0"S8O-MM(@P p$`d<10000(0  00[ Q`$ 0 `;/0 `P Mߍ ᜌP 03/P 00  $ 0:/P 000 ^PMߍ >p@-@0@02APLs07LUa`L~0 0LWLP V~u0|0 ^P0ppO-KM P30 0뀰@p@ @@@$@@@(@ 0 0Cs0S;0fSR >"SF [Sl2 0 @3/P 0`0  0lX@  0 0Cs0S<//Q /@- poA-PQ`@   F0o@p @|\>̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SS `,`0 S S0p p S ;S 0 S S0GU0 RP0/S8 0(00>S; SB 0S p@03  0Bs0SR  0 S S6 S4 /S 0 S S,/S >S S`FVw0St `Vo0(00>Spi0   $ 00 0  S =SB0"SO0SL   0"R "R R?C$ >R:0ؔH C-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R@" tRT Ѝ mR8 pR oR sR ;R@' tR ;R@>P P"Po \P@ V   WP UP PS00S@Ѝ pR ;R@ uR [R \ BR   ;R@<{  @!1 0 ʫ"R /R  0iP 0 +r  R:Y  Yy)     SP R0g* \Rd  uR` < PZ +r PV*6I0 r 0 P P#*-"-  P P* --  &0     ) | @ ԑO--@` M@  0Ds0S<bSSS  0>S 0 T  @P (0SP  R @-% ЍT T$ @PV `qP  @P \ fPG0S  0S ԎH>G-P-MY`b#@PL ,pC pF 0F fpppS>0 jP Pu&  0 p `yB$Ѝ000 Dp``-$`Ѝ `$Ao/A-PP #P`p @"@Pz$@@"@P p40,p0P4080<0C  @-@8 @-$@@ ⎠|H52@-@@O-4@T ,p P @Dp@Ѥ@T `P煑Q@0< <0 ༩PZ PZ Pd8y x @-R 0P< P 4Q ,  D )@0@ 0 , (0( 0 x \x p@-M@4 00R1SP,0SFR 1`V. P` 0 0!P 40, 0C40P& `ЍpS( R##ЍpЍp Z0 0D :p yl0l 0D 1X cT0T 0D (@ i<0< 0D 8w pw Lv t(v ̈A-P`,p"@P W 0 !:,@0`W#,@0`C-`0M@SPpD  P=#{00Ѝ!0 P ,0ST !0 vP ,0S(0S0 0 0UP 0S>0S0"SH0:S ?0}S "S000"S FP  @P d @@ 0DP ", (0( 0\ t̆L\ t X0p@-S \  Q @PPp 0 0 Ps Ȅ0S 40 00$  0  0 @-: ! c,0P \YP |,* x 2t0t 0F/P` W\0\ 0,GH D0D 0 >To Ȁlo Ho p@-@PP0S L  Q<0  0p@ 0 0K/n p@-@P 0`0V PP p l0 0 0@S<0  0pPp( $0$ 0K/<,m P0O-S M@PR z`40SM x `!P@~ ЍP pP 00 0Sq 200PX 0S. @0R*  P# [` P 0 P 0S P'L X 9H` ЍOUP 0  03/P  40R 1#PP 0 0U/Q 00C 0}P |`@zd `0` 0U/8L H0H 0]//@0]p k H{| 0k P~h| k D~D|@-`@ᩝ0,S<SSg  0 0 dj 8}{PG-W pP0`WTW@7 404 S @  S4 G000!,0 000,00$ 00,0, P  ?o @ 2\0S0S P@P : p n404 SS@ b @D !@0@ 0c/, 7(0( 0c/ h |yh |yG-PS @- Y`' T 1p 0R   004 00R% TP 0S 0 Gad 1`0` 0i/N0,S, (0( 0F/=p g {xDg $y|xA-@P-& 0 0R!p4P 40S P,0aP0#   8 ,0040U:8 408 00P 0  Q@-P80080/xp@-P@80080p@p@-@P 80 0R@ pP4@pp@-@P \0 0R@ p`P}00S@#:wp@p@-P@j@epA-PP 0 0R4pt`U40S @40@S ,0o PD `= A-@P 0`0VpP.0S P @T @ <0< 0]/_@@hc wuA-`P /o0P0"Q@@T @0R p [@P @T @ 0 0]/%b vt0P \@- ^ 400\@/ 0 0F/hb Hts0P @-ox@ T\ @\400\@/ 0 0F/ޣha ss@-PP M @1 0R Ѝ`@80  Ѝ@~ P 4 0R S!*,\&1 B!p@夋400C40<00<09 7 h ud0d 0s/P vL0L 0s/8 w404 0s/` hsq` 4tq`` $tq P/4?o 2 R0S/0@ S/P0P D- ?o2 ^0S 0 S / P/0 0@0R/P/0 0@0R/ P H0-0/o@0"^ R  R /\X 0S /A-`@PpP (0Sp 0P  pA ` `ZhO-0S@9 0@S7  `A P. X8qPp@. P ( P " P HPX0UUUB#1 !0@<  ?,B PO 0s 0 ઢX% X@0Pp#r 1XP7 0 03/P0  40R 1#[P' `P 00C 0;P  @ꀐ pG \ X0X 0 8 404 0 ߜ\lx7<H U[H XT[40S 0C40/ 0 0 @-Ŝ4H \Z0p@-S \  Q @PoPjp i0 0 ड़LG (ZlZp@-@P 0`0VPN0S R<0  0p@AD @0@ 0 ~, w(0( 0 uG YYF hYYSG- p)W@ `V 0P 0R 00 ]` V 0S  Gx@ <0< 0F/70,SE YXA-PP 0 0R4pP 40S @,0a, 40a@T:8 408 p@-P80080p@-@P 80 0R@ pP0@p,p@-@P 80 0R@ pP4@pp@-@P \0 0R@ p`P|00S@#:vp@p@-P@i+@dpp@-P@]80080p@Vp@-P@Q8@N@@pp@-@P 0 0R`P>40S ,0AT 5p@p@ a0 0O/kB lRUA-@P 0P 0R@ p`8040S ,0X ,0Q<00<0@@G@D @0@ 0S/., (0( 0S/%A UTA UlTp@-@P H0 0R@ p`P@pA-PP1 0R`@4P%80,0!qW% P P ,0P < 0@400<0AkAD @0@ 0W/Ț, (0( 0W/࿚`<@ 4TR@ OR0P D- ?o2 ^0S 0 Sf/,0S /p@-`P@rP (0S p p@ %x " \0 //@-DUP0p 0 kR0@ RO-IMP  @T `p0 R 2/0/U\ P Y  9/0  pEPV @T!1 0 6003/Y@ 9/T TT T @T@" 000Q 1/0T' P70S+ 03/P. Y 9/T@T 0 0(  0 0 Iߍ 0 0(  0 0( יY 9/Z 0 03/X T0T 0( ęd? PRR\> HQQ8> (QP > PP= PP= PTPP0/O-MM(p@ aT 000 000R+`P$  T%0 `P4  0@ 4/@P`P@003/0 @oPMߍT0 00 P $ 0R000 Mߍ0 #,0, 0H F R00; N\N 0/0/@-@@ A-pPM`P1 @T. 0@0W  WS 0A/R 0CW /RW  W0 0 B/Q 0C#@T @! @100 .00ὔ 0 R* 0 03jp@  JU P}@Pۍ?00@ۍ S0]p Pp {p PT@dM p@-R 0@S PR :   Pp^0P  ,0 `09\ \0 L0:H H0 80;4 40 wpK09 KL9 KL8 Kp@-@Q PPpQp0A-SMzPA@`7 Q <Q& >Q &Q a`Q PЍP QЍ|a&`Q ~PPa&`Q rPPU q/UpU"0E'S0 rP\\P WP PU /U\U fPnPtPbPUx 0  U"QQ 3P0 ,0, 0 ԗKKJ<7 Jl6 TA0I 0S p@-P@ Pp 0@Sp/p@-@QP Q PpQ p@0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Q>p@ #0 0@ a4 ?dG0p@-S+@PPU Q PpQp<Pp/P PQ P Q>p@ Q0 0` %3 >tF0p@-SG@`PU Q Q bP<]Pp PU Q QP QPU Q DP QpPQ 7P Q//P >p@) c0 0| ͖P2 8=EA-PP_ 0Q`pp XpWU@PQ  PJ N 0VC p` 8/PP`<``Q P P 0S )P P PP\ X P P 0 P 1 @D`p@-P@PP  !P႘`~`p yx011/@-@$Mp`PP P1S$80 02P m C$ЍP 800p`P10  @80A4 40 $0B 0 B|0 BB\0 B@-@^ P ^%QRS  T00;QNRS"  TŒ 00 Z0 0 ĕd/ BAG-@R(MP00Q P 0 ` p Pl `N0T?o20S00(Ѝp`0 A0 0000000 0 00Q0/0 0000000 0 00P0/-0 2/   \-0 2/    \p@-@P(MP`/ 0S, R00$P (Ѝp0-S 0 0 0 0 0 0 0 0 0  rX P0V00(Ѝp@ R 0S V00?PQ0 @0/@-@p00T000@-@T @-@T000 000S/@-Ӗp000 000S/@-Ö\p000 000S/@-㳖p000 000S/@-㣖p000 000S/@-㓖p000 000S/@-ブ\p000 000S/@-sp000 000S/@-cp000 000S/@-Sp000 000S/@-C\p @- @?^ 0."00@S  \ . P0?0? 0bR0^ < 0  0^ \#謓X0 02#/Ȓ0 00#/ᬒ0 02# /ሒ0S@-@1/00/T0T0p@-@ P`0S ?Ppp͕p/000 000S-/@-㻕-<p@-000 000S/@-㨕pAo//p0@-@ MP  vHP Ѝ00; 0 ୓9h& 9p@-@M  wDwP pЍ$0; 0 9& D9p0@-P M@ T T T  0 Ѝ0 H@I Ѝ00: 0 gt8h% 8p@-@ ^B @108 0 Q8% 8p@-@PP [$@Dp07 0 <,0 m DЍ0; 0 $A# 7@-@P ( 07 0 (@# 7@-@P $ 07 0 Ӓ$@x# 7R/-~x` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//-~x` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pᜍ8U5U5E03#0@3#C#!@11@  /  <Ԍp@-PQ@p : Sf G Sd0 ] Sp0  S?0c0 !-0r-w0-0 R00G >Rx  -   r -  w -  Q  1 &Qx-2r-@w- TT Tt T-x 00p Ss0  Sw0 S?0l0Q s! R0s  SS   S?0b0A0a0-009 0 ipr 2O-P4A@:  pPA PA  RpP% 00` 0@T' QP0=S AP` AT BX ! مD0>@ @0  00= 0C-PMTT"PP2LB 0@@$LPPf PppX`\0  CXlPےpk  Ԓp` `m n   &p[ p0 0S4P8P ǯ  0v 0 v P +  Ϡ@00Ds Pa0DSW0DA0DS"70DWu X : \R SP P"0 00T; W0 0 p 0 U00S 0 rS 0F0 Ѝ0S U @0` 0000S   Ѝ 㙉 㙙 p噉I㙙A p XR 0AA B PR `@P0?L L0 ໏RWp ppW +< +0M0 00Ѝ300O-PMp 0GW"S00` 0v@AP-TPg +T@`0> ǯ  0u 0 u P +  Ϡ@00Ds Pa0DSW0DA0DS"70DWu X : \R SP KP"0 00T; W0 0 p 0 U00S 0 rS 0F0 Ѝ0S U @0` 0000S   Ѝ 㙉 㙙 p噉I㙙A p XR 0AA B PR `@P0?L L0 RWp ppW x( (0M0 00Ѝ30O-M`P8@@}00QUP7}00Q0/ 0 ~  @-1@R !0/A-pR P@a@T T0 1 !3/pWG /p@-@P{T 0p@/p0@-Q-@M< 0  RPPP 0080P@D0 Ѝ0RP + 00A--@P`M8@ߊ-pPF T0䏊$ U V2 `P@`P@xP1 0 㼀0p 00D $@,P(`0ЍV `@`@U V |`xP`Pl@@`PPTPP@P@Ո00L(H dp@-@PMP& U 0`1S ,0S  㵇$0S  㮇 pЍp@0<< <0 (0;$ $0  T  0 @-@P 0S% *|0 P @0P 0 000 01 1 00|40<0 00 Z[ 0 0 p p@-@PP% U 0`1S ,0S  F$0S  ?*Jqpp@09< <0 '(08$ $0 0  X @ 4 p@-@P {00C0S0 P{p AP07 0  --M  IЍ Ѝ/ -- M0 0H ЍЍ/0P0@-$M R P @0S$  S"b0 0   B! $Ѝ00QL0 @0 P 0S$  >8a|0>P 4000S$/00//=h=4ŸC-PLR <ЍP@0P@0 8Y( @P@ PU IP 0  0 2 \ Ḁ @Pt@P@h0d d0 P0 0s-렚ę -48X - ME ЍA-`p!PPl1!M @00<80H 4000p40 4p%P !1 0 <8 309!ݍP 0 Bp  PP@T Cn`4 P8TPP @T@ṏ嶏00, ,0 ,0З  h (!1 A-@P0!MP0<80a a 0 ` 4 4  ᾄP>44p p岄P2 PD0 p B p 툏PP!@T Cn`4 P8T咄PZP @T@0S  I p0 0 <8 30!ݍ\008LD @0@ 0 {,뤖W0 8UUp (O-@$FM`4 M PQ0琴t0d40㘤 T V [ ZX (d 0H00;P0S 0H PW 0 P(00iP 9$PyPt$-Wk ,Pk($,"iP $W , ya X#P3 0 d4 30Fލ Ѝ, 0}P3 ࠀPᛀPt / ᚁP@ @W  E0Sw SU2"0  @ 8x t C80XX 9.P(( ,!"y 2  03TB!z1 0(V9!{1 0[0!_1 0&!0  m80$0SX / H! 0 P  X8 1!0  @ L8  2@  ;+ 뀔d d` (    `| 4,  l L @-PP!`PL1M @00008  pGT TU00P @%@P@ 0 0 0 30(Ѝn/00U000000(~P0?s00L H0H 0( NOPKP*ll X$ @-@P  @ ~0 0< , O-MMP㴲!"  2,$00|404(0 ,0S 0S 0S $0Sy `0@  4 A00Ap@ P82x`p00380 Mp@! R TPS߃00S" ۃ@0=S`T`V`W`V `dpPȃ0#S7 8PU0 @800C80괃 4@x  P# @Px4 PP 0 t `T$ 4n@$ .n  4PPhP((LD  @  | Lp(0S800C80  0<0pP p`8p 0 v | p|0X0P@5P5XP)0 0~Pھ5 40xC  Y(0y0Se Sc P| > P| 7$P| 0 JP< R10-"2 0 |4 30ݍЍ0@ڂd\"\0 @ 0  <(080<0 S  P 8pW (0!0 0 <    `Pᆞ P႞ P`l#p3p H 0{#3 0H z 0Sl#3 H 0nb#3 0H d,0SP#3 H 0XFY0S >,8,0D08pXd'(C-` "p2TM PPp@0t0L00A VJ WS X\ t!,@ Ͽ |0U x0P 00 C0 APLQ PA,@K@l@0 @ !0 0 L0 306TЍ 0 P 0V 0 P 0W 0 P 0X |0| P 0@Ɋ@ P(XHEP \x 0L | `-M]ЍO-Ph"`d2\M @P p0焠刐0T00W U` Vi Xr 4" w p0 P00 0  C0 坊Pc0Q ,  lP 0S 0 @`H!01 0 T0 30C\Ѝs0  )@ i0 \ 0!U j0 \ 0V k0 \ 0 X l0 \ 0@@ \Kc'ȂB p D` 4 t-MCЍO-Mp5ph% \ 002000@pW3 [< 0S$ Go0 0-0P xpPf 1 S S   $@ $ S^  000 S SR S0 R R R R @ RQ  B RQS 0S1 @+S6 -SYQU @U0S 0S 0  00_o`R0+S4 -SF m{PPUpxP XPLe8 Pp S 0QUL @UH0S 0Sc 0  000+S_oR0S] @S=0 PP !P P0S @S 0 |0`SP{PPU@ "1 0 2 30uߍ 0+S3 -S0S  `P{0+S$ -Sz0S 0+S& -S P kp0S P S!@#0Si 0S  r 90S P{00 0 0 d 0}t p0p d 0}[T 1P0P d 0v}% \|` 8 ` DO-P<#@83M MpP`0080u T~ X 2U 0&N M.0A 0;TPY 0SV P +i+i 0 < 0  02XPP @PP3H0: SW 2"0 &P 7  !1 0 8 30lލЍ_P 0 @PP - 7100SPp1p!0 &`!\1\ t 0|T@!<1< t 0|Xw !1 t 0|m{7 ~P \0S  S 0 0 &0 0 &H0 0 0 &0  @P%z|:l@9xd<8( 8D` 4 l77p7xA-@P0M`p4 V= W& P  0 B  헇P @T@T 0 pPP i0Ѝ @cPx ^t0t 0;|\ X0X 01|V< ]808 0&|p X  -$M0l L` !Π@ 0 (0 0 0 30$Ѝd$tt-$Ml0L ` !ΠA 0 (0 0 0 30$Ѝ>$4tsG-` @PP  B~|0000 C Ra CREp0pY)00 C Ra CRA CRS:Y 00Cx QaCQWC@00Cq PUaCQWCQACQ7CMS  0GSRQZ / S V*@G0 TT-@A CRSd p A BRGZ00V0S^  Z?0Z*Y 00As Pa0ASW0AA0AS70AQ @410!00 ?{0 0Cq P0@p W:aCQW0CACQ70CS 0} 0 {000GACQ7Cx|0Cx x0 { Bp^Sz @Y@0`< <0 z L( t |` 4O- l1@0`@? ` R<T !4*4.0q0 ,p( ??p?0 SP#20Q *00\*0V0 R* Q *0V000?0R*00t?RPp1?p# { R ? Q*:  T: 6666 65@-PL@ MH0`@p400 0ό@| Ѝnd@-@PM  0 0 T0 H  @Ѝ$03 0 Jz5` @-@P(M" $0  0 0 0 0a=P d0 $0 $(, (Ѝ( B$0$ 0 z440 4p@-`P0M@P& T/ U8 ,0 0(0 (0 $000P#=P00 04(8, $< 00Ѝp 0 0 yTt p0p 0 yUT P0P 0 y{ 0 @ D  T0"02 O-P0TM`0L00v Vj 80  00 0 0 ! PPO @p 0 p@P< 0+S+0S((P,0(0 $0 00P0 $T,$,0S4 0 0 L0 30*TЍ0  9P 3WP3?{00h Yd0d 0D /yL XH0H 0D %y~!Pki t x!1 O-IM0p010tWW jPPN x@` "0 `@P; 0+S+0S(dP  0   wP   0S3 0 0 1 30Iߍ P uPq3z00< 808 0T x!httgx l|0/."2 0@-@P0\MP0T00 U @. <2_.p@ 00@ JMK 0 1 2@3@K4 5@6@K7 8@9@K: ;@<@K = >@?@ !" #$% &'( )*+ , -.0/0+ ; Ep d0 0 T0 30\Ѝ0!PPv004, ,0 wjc f4 d| !1 @-@PFM0 Mp0d40. ` !;PPd@!0+* P y@>y R@(d \0 0 d4 30Fލ Ѝ0 N,0, 0 w Ddc pH@-P pP0dM `00\00 @ӌ X P0 0 \0 30 dЍ0 h,0, 0( vwcb |99@-M8@ 4@d0 ЍX)l0P1Spp// 0 0@-PP0M@000& T %MP0 ^#2 0L00(0p d0 0 0 30Ѝ0)@P00F, ,0 waT b@`'9:E`<  `&-H@` 'd@ l "D`4O 8!  -falP,(5_͌b! @ppp& 7x!t 9l '8*. p" pp' p|`@$;`,P%` ( `&}`am8 )  " gq-9* $@!@@$ @fa01.' +)$Mb!.p &7 dA(, 4" P%͌9n `* ! o `P%(( *_ᘀ!L$` PlP .8  "**!+P.$_p'+**뿠0ꯠ p' p',``篠pp@ p-$ 7@$"4 *O)+ꯠ"뿠( `)4` *"`/L)뿠 * 韠 / `, ( ( *( $`菠 $p'af! p' 杉 p'  `(`& `&珠`&p! pio ` `"``&p',` p͌$P%P%nP%0(_,PP) 0 P0 P%4@$ &` Pl " `@$(P "@$oO .0@ ` "P, ;>FP%@-@ (@P,a.P .P%Mb!  P % P! ,P%,dA쟠 *$ P͌ 0P P௠" nP] (p$! p'l+ p.+ p'  eQ @ p!-@$,p +@$p, @$p'`뿠O4@@@@@pM'p%.p'.b! p '0p,p ,pϠ P,$pPdA],4p,,p"p'nϠ  (p͌ p  p$p'eQ$$ p  "p " "p. p'l/ (   (@ ,p-@$p@$@$ p%p'`O @ @@@ @p.M ..p,p'b! ,,P0pP%4pP%pP%p p'dA_$PP`& PP `& ] `&0`"`&0 ` n `͌ `$`&eQ( ( `($ `@( . ")l`) %@0 "@0菠4P@, * !( "!, "m`!⏠ ,M "fa00d=@, /H@ ) +@韠 +@ + @믠$%c1 P ͌aA࿠ %0P!`!_4PP PlP(P&`. .`Q 0&,`0# 0#0 a00 @0&4@ ` =O@nA  & `, , c1$P&0P`,P, `PϠ`PP&P !$`! ]  n(&`  eaO @ ,@PPp'4@0p'p'(P0@0 0@ @n@ 0% P 0#M 0#`Q,$p?ppp, } dA ` 0͌))$`)`g`pp`` (`( p( pm菠(0pl P(fqP%P% _,P P ` P`PP4@P* @]*@@ @n@(`*+ M ( (ePoP4菠  P 佋P* p,$,p' P%  P%  p' $! b*LdA`$`8`00͌`8`0`) `&k0_00`=.`.0`. `$ `& l `(`&`& P+柂`P%@@ P4`((c1P`& P`&p,Mo ``, ` n`pp0#m0#dA ,0.=.faP@$@$c1 @`&M`&n`0#,Pm0#dA0.=.fa$@$@$c1,@0P`&M`&n`P0#m0#dAP0.=.fa@$ @$c1 4@`&M`&n P`0#m,0#8dA0 .=.ψfa@$ @$@p <-`XTDc1H@0#0#\0͌ P   Cl00 0 30ЍL0H H0 qN400 00 q?DK \ `@-@P +;0   *DC< 808 0 oq #EgܺvT2l 4G-PPp`7 W+ 100.!؁0% "0 0%0?S@@h  Or 0hS@H"p ` *0V@@p`F  G8rH D0D 0 (q, (0( 0 qP |Ⱦ( !1 p@-PP0M@0 00@ TI  0QX+ ;MdiDithTh&$  0~? S a`4` 0~? S  ~U E "0 0R1<30 0 0 0 30Ѝpx t0t 0( pTX T0T 0( p" H` G , P 0 0@-PP0M@000& T MP0 ^#2 0L00(0p d0 0 0 30Ѝ0)@P00F, ,0 ipG FD 4G-p!M@1M ࠐ0 (U050,ePG0R W0DA +@P2  lPUo0 ;u0 UB @P  YU0PUo0r@r@  o 0 0 5 30 ܍Ѝ rPzrTP  0gQjPppP|`]WED- M 0  Ѝ@-P pP0lM `00d00 #   #X P0 0 d0 30 lЍ0 ,0, 0$ o CC `  13L @0+/ #EgܺvT2O-MH@@P  @0\;\ 0EHp  @P` , ` $  p(l̆  L "芆 P Pp%p'd+@pePgyPP @@!lˠ(@H)P P@PTh@P%阀b+Pl@' @$Z`@``Xg{`&dJ`) \ai Pid e[, $.dKtȂn  fk " `p ((` 茉 Xplp lˠ!p.p'n p|{ PPb+P% Ph@()\h隀`@@``a`&`@' @$g{@l p,I) te[l̂i` h|  fk " $.dKL* lˠ!xp (a` h ppxp PPb+P%Pp.p'n peY|@T0`` 0`&a `fʌ`(`&h`'`@g{k )e[+$1 MxB /+S# /S/--M  mЍ Ѝ/0 2 0c <cA-@PMb  `Pp0 pp p[ \ ,0pp  pO R ,0pp  pC H ,0pp  p( P0@ 0 20p  B@RQ 1 ! \' +0̠ p`Ѝj0 S sD0<@ @0 xh 00~ @-PR0 00// @-Mp @h``PW0D P>S 0!3100 0hЍ>SH 0!3100h00h00h /-p@-Mh@P@U0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0( $ s4A-@PP`p< =U( X0ES! S0 +0E0VP00VP&2!0` `000+W -W =W00V-0`0=+00+000@00,0]( (0 @f00Tv 4u 8p@-PP@D 4a `0RuSpWS4X0CS0 pP0R Q PSPQPQ  0   I0 0+S -Sp0$ b 0  0 eBu t ВO-TM0wSp _@@0`   0(0g @(* g@T%x7(P00p0000TGP @ 0 @8$a0GS00 g00g@g@PTЍ+W = W0 -S0000 0` X B R  = GS/o"!"   ( P:0,Pkg , dg R, "( @0偑@P(  ( 0S# (p W:,PIgp , Ag0S,0"@(p剑pGPp(pW X0[0p0 0I00(ppW ,Wp`uS(`! Y0`,Pg ,y g Rn, "0@(`剑`FP`(`  n`(=W +0G?oR20S$ Y,Pf `,N f0SC,0""(` @႑`FP`(`V 0[` 0I00X00F0(` 0 V:,Pf `,) f0S,0""(` @႑`FP`(`0X 000($ KR; I?I00 KR<I f$ 0@$00S`f0"SE  V*(@ T:,Pf @, {f0S,@(00CP@(@T| - ? 0+ 0 `0TЍ'p  001]!0 Ld1]!0 Cdl1Fs>f00(0UpL 0Xp+`-@ +B XR R  0+B -R +R XR 0 -R  X@P`Qpl0]h h0 cyT oP0P 0 cTs vs d$n h@n DԊl ؊tl 0@-@PMP  0 @ p`Ѝ0$0: 0 c k 00P P C C C//o`/00/00/00/ 00// /0/0/ 0 /0 // /A-@pe`,U+P(UU PU  0 =P@P PPr_aP X000Jp@000/eP)ePĈ_P0p@-0P`@T @T0rS PpLp@}{P0+Spp@=;m\0@-$M0P0200q 0Sw 0P 0Q 1 00S%X,p@5 P" X0rSE 0 0P?1 x!00 P @00S7$Ѝ0@$1$!$0  @6d@sX0 00S    d@PG0 0P 0P$Ѝ0h0d d0 rbP0L L0 ib~Ppl\wPwHwLw̱@f X\f 40@-$MP !e 0Sl 0P0A 1 00S=p@' P 0rS; 0 0Pd1X!00 P @00S-$Ѝ0d0 00S@ 1}{d@P 0 0Pg|0P$Ѝ0` \0\  0aD @0@  0a pPd | d @-PPXA M@I L1p0S+<1@T4 `0`S@' 0Sj0V0, 0S%Pc0S  y?p  Ѝ0@T0S pc00XL  0@ <0< 0 oa pԭb LG-`PHMP6 p00 0p@  Wp@ HЍ P 0 p Ap@ [HЍ1c0S @XH0>D D0 aC0P R@Pa XO-P4M@P\p WuX0S7 `00 S 6/000 00!S5+0 0 00!WmW0i Yg X00U7:GS> G1@000`"  0 P(0@`0p(5`0$0XY\ 0S=0`hW A,` 0\VW ,@P(05#K 0T`X2@ 0 $ $Q T  S #.E!b)L@T(\/H0#"A $1?"!!#: 0`V4Ѝ3+00 00!m3/0 00!ft30$0H\/Ld0L``00|2pST , P` @!`[P 0V @ P ,Pw P[$:6S T00U$0%%>!E!2c(\/H)L0TP%"1 #1O"QX0 "0 0 0$00?S%D P@(`S8 5HT1>O0 0` 0 0T &.60S 0 0 @0P(0\10X00`d(0@t0P`d(0 P[  R3@< 0!0?O0Q쀟p@pP@0 YU X 0|Y 0 0P rY 0 0X iYt0 0bYX 0]Y@-@+4L?C chbC hbbhC Dba bO-`QM@Mp R W T  DI :Z^ @P@\ [\ {\P }\U PE0]\\ \8(5PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B0S008( L0 SV 0F 0C0  Y0 0 @ ]RR ]RR y| x0x d 0XX WeT FP0P d 0XY8 404 d 0XMT@ t_^ @ P_^? ^^p@-@PM`P( V1 0  0S0 030{S 0\ {\ 0 P Ѝp0}S0S Ѝp@zd `0` 0p KXVD @0@ 0p @XAZ 0 > ^|]> ]P]A-MMPp@PP` G; 00000 00< 0 ; S \00  ލЍ @R0B \ 0 \\ \0@\9ލЍ 0 | 0WP= p\[p@-`P Pp@0T@D1 0CPP @T*000p 0 0 W< [@[0S$ - *S ?0Cs\S0 P0S Q 0S 0 0/T< p@- 0@TpP"TC ^ (a` DR'   @T7 "T-  P0\T "R @T& @ 0 BQ R 00p@T "T P0 # p P@.0T\00p4< p@-` QQM P1M0P050 - 0 0 5 30-QލЍp @0  ̠%p @EOp 0 5\\PDU8  0P0S됴8: X\l\5C-0eM$`P 500S E p@#S!X0 p]P$ 0S (%P @ 0SX0SЍt ` p @0S pG4 0  0Sx t刄刔p 0fS0fS 00S3R0 <$ 0000@SV 0oS 0oS0nS 00S3R0 # 000 _SP 00S3R0 x# 000 JSP 00S3R0 (# 000 5SP( 00S3R05 " 000 0#S 2 0@ R@@GP00Ѝ0 S Sd SP 00S3R0 (" 0@00q RP  RP4 00S3R0+ ! 0 00T 00S3R0 ! 000EtP `⚽@0S0 @  RP =QaG  0P00 RP=Q 0 0@0 ˟BG  0P0 0L(d,(W,W0W<@TTT ЮS5 S,hST4 R,Sp@-PP xaRP c@PLPPP 00p( I$0$ 0 +U Rج3 (R,RQ@-,@@P00`O-`(@8M pPP0000800 UVZTy 4JpJ009_0  H  W ~P Us ?pp0 0 0000S> A0$00 0$p P2V<000S[  qUUW p'd7 0 0 30 Ѝ`s?0l0` 㰘pp  PWpJ 0BqQ #S P BqQ #S Q BqQ #S V BqQ #S S BqQ #S R BqQ #S# I BqQ #S% H BqQ #S$ G BqQ #S< L BqQ #ST M BqQ #SJ N BqQ #S@ O BqQ #S9 D BqQ #S  E BqQ #S F BqQ #R 0S:U 0p0S8 Rg BD{ P 0`000  00  h$   H40000   $$   40000S0 @  # 00   pW p[ pU00!@U@W 0W U000S U 00UZ 0 [ U00@U@00h@@,0 pC4 (@(y [  Pk0S[}+ T $2_ " 0 PSNQU00$U  ~pd 0(@ 00@pc mpu0`00V0`0 0SCO \qp XZ*0p0\0 U0SY00O pm0S01  ;pC`00C0%  /p7pNpKpHT[; 2pAkp,pk> T  LKpJ+ JJA\JII- M0ˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpF:5pP AP Ѝp|G-Pp= A@0S%A@Q0)lPPR @@ P p0  T*  p0 p0 ,0<( (0 MR`L,((G' 0Gp@-p`pP`PI@T T0T0 R@@=pNP002p(pA-`pP@p@$0S x@@M R"@\ S@"P00S@$pxo@- 00 p@-`MPE@P 0S!L0 V ! U@Ѝp  0P  R 0QPG B&R  4(RS% S @  S& J S E S  A0 Aכ 6 AΛp 0 dAśT ; EP P@\ P 0S p400#S \ P 0S 8d84`0`\ P 0S d4`0`\ P 0S 30 B\ 0P 0S n30\ 0P 0S nd30\3PEX+0 ` =<3P00\ @P 0S [LPP[[ MP200xS| "x2 0 4 30BލЍR@P\ VPx 0S \200#SL \ GP 0S $2$R0P\ 9P_ 0S 100xS0xS0S) 10 0sS?0wS<0!S 71Q0P \ 0P 0S ;nd10\ 0P 0S .n410(10P" 0 $0xS0S {00  00 0000.MPC# t # " d, j4,! X $, L<\?d??Иhp@-d@@0S P Hp@P@P 4;P ືpė=@p@-@P$ P0P 4P ɚPPLP WPph`h`PLp4 000 0 OT8@=X?l  7=p@-@P$ P0P 4P PPLP Pph`h`PLTp4 000 0 ZOlPX<p>8 6(<p@-0\PP 4P Wp<`<`P@&p茕;=@-@@P 00O-@P$MH  0S Zp 9` P0 0p V0;  8000s?Q WQN *Q0@0 8000*S' .Q S /S$" /@PP$Ѝ[S5 \S/ 0Q@0?Sc S *S0@V0*SV0 ' *S0  0*S [P$Ѝ[QLX /X| 0!S^SV J  Ɵ  P 000@ p0]S2^ -Py 0]S00S /SD .SDB 0S} = 0U/S:w\Qv 0@r/P P]S /S \S$ S] -P8 0QV]P 0ZJ q  @0PR ?=P@ PV0@0S 00T+ 0-S T~VP]P0p | P]P \P^ S0S00@00  $ P   R   U/R S /S T 0-S T@0vQ@0QRS@00]SQ-P ]Ho0᪢\ V@T S0TF 0Z q R[XP 0Z q  @0PVH2{D"D0 YM0S:(2|$"$0 NM1Ql0 @w^a 0-S5 ^03 Q@OS JpP@0V0  ! @T3 0 Pc/T @0 0 0 @@T S0T0_ />/0]S_ /Sc \S L2L X4T4  ,4@0P@-@ P N 0 Q 8Q R?o 2c11p@-@lPIP XIP T00pT 00pN 0 p11O-M"0  "  ᧻pc P   1 0230Zߍ PT 0 ᄻp H  P7 R @;` 0  0P P& PP 0 lpP 0 QP0@T*p@ "M 0 OpP N - R  p ,O-M"0  "  pc P   1 0230Zߍ qPT 0 p H  c P7 R @;` 0  0P IP& PP 0 pP 0 ƺP0@T*p@ L 0 ĺpP M - R  d O-M"0  "  ᑺpc P   1 0230Zߍ PT 0 np H  P7 R @;` 0  0P P& PP 0 VpP 0 ;P0@T*p@ L 0 9pP M - R  ` Dp@-`P@P@ \PPpPP p p@-`P@P@ PPpPP p p@-`P@P@ :PPpPP p 0 00 -H- M0 S0 0 0 0 00 00\100M\   0S08 00 0 0 30KH Ѝ/خP-H- M0 S0 0 0 0 00 00\100M\  0S0 8 00 0 0 30KH Ѝ/h -- M0 0'--M  --M  A-PPp`p V" Q @Q PD@t0 0000AgL0H H0 I400 00 I0Ȭ &&x &0P R   0//O<'<7 O-@P0p0% ,00 E @ `80- p `,ap840D4@0< 4 0p 4 0p d4d 0p @4@ 0p 4 0pP 3 0pT 3 0p  3002#8"03002p * #(|3& 00#(2h3* 00#(2T3. 00#(3@32 0 00" R  $p Ep 0 p  a  R ] 0@sq[  1-)%!zp     p(p    ip 2`Ir0@0p0\p⾒2#8"0  !@R@t@p005T0AW5 V2H@00V!0 0 40 30,<Ѝ 2l10p!   P3 $EPX00X0!h0 0 G:d먫N@Ȃ%%(d%L%4L$$$H@$t##\x#0P#(#| """|"X"D"0" }D}@| 0p@-@P> 0S0 PC0@0T9  T04 0R/Q T:\% 0 \/RT0C"/QT 0C: B0PU0P!Tl00p\@@PT H08@@0/S $@@@@L|4|D|A-MP`B,A@0P; !0Cp0 0 0    0 b0C S'0 pGI0 0z0S@P 0S 0S5I0"S D5#@0Ѝ T1r0:$I00 ? |@-@P6 0S/ B@T3 0T/  0C/Q T% !@# *0P@/S  B3@T@!0 0G  Q B3@T@!@@4@0/S @}-DM0  000張p 800S DЍp@-`P,p P@p V U p~@p`صUP p` ɵƵõVQ?o?o 0@-@c^?c(0C^! ^ P@`c5$pC&5'&`c 05D0c 11P!  "0P;:0 /0 @- / 005D 0-0+CP0SD 0@0KE0 0/0E 005D 0-1+CP0SD q@1KE0 p0 Q/ 0E/ !0PQoo A-@@`T?`(@T# T `Pp`6@6&p`376U8`1010S00#!Q00;:00 /0 @- /003D  0+C 0/ A0C0+03D  Q1+C p0 Q/A0C JK@ @-Hp A J@@ @-=p J@ @-p J@ @-pPP `@-G00p@-@PP  p@ҳ01 0 iE ?0/R//R/?0S/R/P/R/p@-MPP`V ⠾@T x00?FЍp :   ,p@`$ ]@{ { 00 R ʴz,@-KG00 0S@[Lz51Ed 2 Cr0b0aR0cR0A1R 00$I"I B``C/)P( L%@  @ "bQ0"G-@0D \ͬ ̬LP `L,@0L0D QW ^ࠓࠃ Yࠓ^ S\!:O-p(BP`F@ @6P PXY  P (@-P  1M@`00\ |p\ 00S30#^0#02S000R@0 t d0 0 2 30ߍpP @@ @(@0$0Ȗ$O-P 00YP(<Ѝ0 0P( 00 0U 00S  SJ 0 @$`Ph08P `Cp @p? P6P p W R0 0 @$`P0 `Cp @T? P6P pW R0 (000@ 000@(Y(P(PzW0 GS ( ~ +Sy -S0 P000P児ಐ/P:U X P( .! @S \0cP$00 0(0v,50 P(]U0W,00h0p00>0 P5P& p>P 5PP 0(P 00 S7, Y2# 0@ /Y- 0@ 0 00; 00P(/,c0 ,>0dS,0v>C 0C,0P(  E Ϡl b0,0 Y0 00 000 7 ,l,,0 Yv>C 0C0P( 00 0,50 P(0P(PY%S 0,,  ,00C0P( 00 0Yp 0 0 S0P( 0 0 0Y 0L 0 089 00[P(Y{Y8 00JP(=0 P( Y0 0P( n1,,  Y,00C0P(m 00 0y0 0P(_ 00 0k,0 |,0$I"I/A!b!b0C 0P( F 0 Br0 Sf0(0P0Y08p7 00P(?c0 ,P0S,0P(E  E /"bd2#,0 0 0 0 000Y6 00P(Y0 ;0lP 00 S 00Y((P20 0P('(P000,c0 P( 00 000  R 0s @` 0 @00v 0PPII0K1c ` @aa B 0 0 B  004 %!E!/#bb K/) P L@!(,"@aR 3 : ' @aR4 # 3 P b4h$  Q0 00 00 0(0 51E2?3c#cK?)P( L%@#"(<2@bS3: 7 0@bS#3  3  0 "!00C0 0 0@MP, R0PR00=P,0YP @$`p(P 00 00YP @$`p(P  00 0 %!E!/0#bbK/) P L@"(@bQ: 7 0@bS0#03 X"  !1  B00DSd0,0տ0 40(00N~0 S&0̜ ̌ ̜Ľ@@Y_pO OO @D G@Tr 0 40N~ Q@(p0)Pb 0(P0 0(PP @ ACLCq| \^JS S  0 0S3P0 z G/o("PzWw (PUSG ZSP @ P@0 0B(0*ꘕ (<    l)t0PE ,S#P ( P( P%!E"ad2c;S,0<2#TQ(P 厀Ḁ@CP(wMP P(P @{ @C>0P( $(0  @_ 0 @YYP(  00 0ehYP(  00 00@P0SM 00@I0S 0@B 8,00 0 0P , P(01(000C.$0y,a20a\Mc^ P#   0P , P(00(000C.$00 0S,#   0P , P d# (0(00c$0<0M0 00Ѝ<1A-0Q M@PHP PM Q%d1 P01$T G@@ Pp ʵ. R! v` PrU  Ѝ0 P0  PgfF ` La `QUAT 0 ЍX  0 01A00c Pb@-0M@ 80P 00Ѝ@-0M@a0P t00Ѝ@-$P@htap@-PT!pP10M `@00,00@ U5    P00Q Q Q ,Hz 0 0 ,0 30%0Ѝp ,Hj ,Hd@ 0 P0;L L0 }>80:4 40 t>@ d @p@-@PP U 0DPp P @pD07@ @0 Q>U(08$ $0 G>  G-pP`' X/ Y @9VP0PES  R D PE%0V R  RS0@0D@ D0H@ @0 >X(0I$ $0 >  R@- 0BAs @ Q0C@R >@O-PP┡ Mp U WC s2@PI 3PI  2p`M a90101S Y3 Ѝ020P@{2P- 0 0P V20 0  >0=   >l0Dh h0 ='2?0080C4 40 |=N3|t H@ @-RQM @PЍTT d?@ЍЍ[? 00G-`-p!p1@ MP0M050F ?PQ ᨫpI @\B^ X0p00t'0 Oc00 TVE5qύ@0ˠЍ (, @P 0 P |0 0 5 30ݍЍX0DT T0 <>00@>00Vyyx 00- $  M  Ѝ|x--M  CЍ Ѝ/ -- M0 0 ЍЍ/O-@P−Mp ` X X00?U2/00P @ P Ŷ00 00P ! !  FX\3?OPD 0VP WR V[XpPVppPW` @ `f0`0 pPP `C@<<1 0 0Z<W`00 !1 002 ЍpC0 P P001 Ѝ0 1<`ʹpPP V ƴpPP `<0?8 80 <ddwt $X @-@ M1(0S2 M/0 (0p p1/qpP`0)  0 0 PUoR <0PUo1 ЍPPT` 0S  0CPo1=00P`|1@-P Ml1(0S: /0 "(0p p1/qp@`0/  0 0 @ToR <0@ToR11`V ЍP@T` 0S  0C@o=T0051=00.1p@-PPE 0eBS5 @Tp E2 Rp00P0 P 0S PcP0| 00(x 00 t0 So,P k4P g8P cp@貫L0MH H0 0;0Sp(0K$ $0 $; |D Lp@-P$@@"Sp@\R@- @@S@$Rp@-,PP T@ppR@-pPQMPE 1 @ 0`00S P 0 XRp0pPPS8  5'  U80C0GS0S0\^*:ЍU  !P\^#Q.S*p 0A a 0C ƒ0F 0 :! ^#QN^^ N0 Qs0@Hpx |4  R  *4 8/P 0X\S 040:8 R РS /V~lxB@-Pp`,<L@L0@H@ఀ U   %em4@-P`@1<0 A-pP∆`@P( T0  r0 SSS<v S00 S 0060000005%0 9T5%0 9%00  00X50000  ; 70Ls0 20-V00 ^V00;\ 40000 00C!00000LS0 100C0 0?V` 000 00000 \ \ 00y 040000  70Ls0 0 h", 3010P;\ cP3`b0001~dPk R SXd0\Q3 0100 M \; =\K \7 00C00L S h0100C09"000 0  Y 00Ls0f" 0W0Cs0_2 F0nR!  U50#\V00S003%V00S00&0F?o24 00=`Foob%d 00!00   00Ls0! 0W0Cs0 0 #\ 00 0P0h00L 0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP=cP$dP900Ls000Ls0 0<00rP00m mX    |  O-RM@p 8 0SA XPJ T P 0 0`0 @F-PC T@D 00X `R)R)V @F 00#?:00ЍU 00 }0 0/)80Sl h0h /08 R @T 0E00Ѝ:00  0  00  4A-@R`PPm /.#C=1"#BbQqU> 0S$ RT 10 R RO 2/!1U 0000' 1/0P p $@q$0001003/0P!p0  $@V00 00 R (>000P3/0P U  R  SV  0S=ڰP00U F0FxEP|LEXA-@R`P Pm / "H0#BbQqU> 0S$ RT 10 R RO 2/!1U 0 000' 1/0P p $@#00010 03/0P!p0  $@YV00 00 R (㯯00 0P3/0P U   R  SV  0SKP 00U HDC<C@CPA-@P{ Pn2`Pw rpPg  00Rc</.#C="#2caqV8 X p3PXU $00|1p00S T#X1003/P00> 000$0$100S100S 3/  000``0S 000S 3/000(P` p  0000S=㾯P0000@0003/P 0A`AAL@@`@`A-@P{ P1`Pw rp Pg  00Rc</ "H#2caqV8 X p:3PXU $00|1p00S "X1003/P00> 000$0$100S100S 3/  000``0S 000S 3/000(yP` p  000$0S'P 0$000@0003/P 0??8>x>`>>SR: G-P0p`00S 3/0Y @IOP T0 0 0 0 Y @IOP TT0 0 H H0 0p`P   /(=<<<<SR; G-P0p`00S 3/00 Y @IP r T0 0 0 0  Y @IP _ TT0 0 H H0 0p` P $  / <;;;t;O-PPM M Q \ /\I  jP 0P>/\0p Pp 2 `I `\q @` /RR.\*  B R` `F D/0050 0盤pf 0: S%  S/ L/o" R/\ @ DQ8 .PQ [0   YI/R W00Z0`# uP.T  70   RV 50/\p0#0 @ /R0 [ 0/ލ Ѝ@  ᖮލ Ѝ.00i6 [? 0/    P BU600Q6>00L600G600B6?00=600A-@P Q P`\Ppᾭ@P ႣP`V 60"S @600@p@- PHaM`=  /4QP00塬 P; 00^% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P <0 0  5 0 @T6 65p@-@P`P3 V( 0Pp:P@ R0R P:U P0@Sp P P@Rp:UR:Rp@0< <0 |3(0$ $0 s3 \ 00/p@-@PP" U+ PE0R R:Q|Q00Q0S"P0@|R  :RRpT P0P 0 73U4 000 0 ,3pt H |O-M MP ($ 0 p800D40v 0S 0S 0S t4!S S`h`P PP6  㘫pP 00S RD P 0PD*P ` P@U"0 S* Z :S `\S S S 0T:H@DYP U@p+ P `P0 SZj[0@0#QQ 9P6@P00S0 6 p0,P040(000= P 0:R~ p0Rt4@<0 0 G 0(P<4`PC pP> :00`00 [00S  eP@`  ᓼ 0 P P㬠Pv0Sl00aY@D*0 S :S `b[ ` @f `b 0:R& P0R 0E`F00S:S:00`0H F[0 D0 @   20Cy `# pP 0H@D IpG፫P @ p ,P pU ] XD0A0$0p#3 0 D4 30ݍ ЍP@ dPp3 00%@ `pP @eT3@00S0,P`UA ԫ`P0U;S< 3@ǫ3@00"2 0 10S"B2 0 10Sv" 2 0 y10Smh" d2d  0m1c  ܟ0@ቫ0S> 0H.H0 *4>0.00 ) !0A`0`0S0 $P; 0P0C0S 0000`0S00P 0S0 00停0S0`000 0 p$0P P0C0 SP 0`[00S`0`0Sʶ00S0Sp!p3`0 S ` 0<P 0P `0 0000W `pG00Pp0W0S`J0000P0`0S 00e{00S 0`0[RP0000'  0 P!P+P  P00S0`050停0SU[PQ E!p,0^W000`p000`(0)W- ,0&0P$0$ 0 ` @0-S ]S `/ S) p`0!0S<0Sp!p3P 0 09000 XPpG0SW ` sP `0C ) 0 >p P p XPpG 8`Fp0V6` 0 m΍pC1W,p!pH0 +0BMS00 Ym0H0 00C0SZ000pWH\0XS 00 0,k! 0        H 00 0,0L0 P003 0B SB*n ,`zX0,`007 F<0407 0080@PDPBQ + E "P^  AQP Q ` 00ERS #P 0 000 0XRe 000S "P 00 040pW W"80Q QWWp5m00@)Up $ !_U$ oQ <`F@P Rp1*VV 00,0`pV_  0,H  ql 00 400S H0S 0 0 0P(UpnNQphAQpc+ E* NU[ V0Ul IU} W@ @`h  ,000\l300YYl  m( $$( P: < @P )!P& 0 0"S4 !Px 0 0PRS 0Sl  dP HiU nU& D0U 0 SOP> X 00 0 ;0=>0>,00S,6P( V  0@00LHLHr p , 0 s 00 @k 00 ;00C00S0 S0p0kX0  Rw `  R+ p V0 B0 # RP0 `pHp  RX 0H  R7  X B   H 00+ 0SP HW pA 0 `0 000L.-Ȏ T ( 8 ‰ (ԫ \ D   ~ d| HpQXL`P 0 p(` 0T000$0 P7 p0C $D' 0 p# P p1 ἠp ᷠ0S (0PS0`0C00S 0S p㿠P0 0@00:KP (pY X 00 0r0S;P W( V0]Yz Qw P 0Pn0@(p04`0@p T t``P `P$00 @0P, @0P,`4` pP Pa P P Px P 034#40 %00C. 00sW( pw Wx(,0\30LH0\-  `-p0S0`0 Y1 0  P0` S0 B 00 RP  3YPL`p 0` 0x400  R?o20S,Y' `pHp0 H0PX B   H  0SXP H0 ` H00CP4W ᲟP p0CA %> ,0 0zp0 P s ᢟPY0`P pp0C00SP WW ,0z/,0ZA-@P`pm0 DPn@-` MHP@pZ<0P 000-PW Ѝ@A-@Q8R`Pv v $200S8 80P1S010r F00v`0P$ pW@0PD PP^ 0 n%00P0 0 C `C0000 Q  Q*RQ1 #@0000 B`0P%00P0s0 ʜP +00 #B0T0`P P0 $ B0 ` x ܜp@-@P ~Pp0@-P$L M`T 0S pW 0 7/@P Ѝ%@ Ѝ$08 0 #0pw 0M 00 0Ѝ0A-P$LM`pT 0S $X  0 8/@P Ѝ%@ Ѝ( p$0$ 0 #0$w d40M0 00Ѝ0A-P$LM`pT 0S (X  0 8/@P Ѝl%@ Ѝ( y$0$ 0, \#0(v P0M0 00Ѝ0A-P$LM`pT 0S 4X  0 8/@P Ѝ3%@ Ѝ( $0$ 0D ##048u l0M0 00ЍO-MPpD@@`V` T6 0US`$[G 0SD `VA 0 6/0S+ $l @V 0S HZ 0 :/@PЍ$@Ѝ0$lV 0 0 "0H [0 0 "0h Jd0d 0h "0`D }@0@ \ 0"s <s Ts $s ,4(@- @MsЍ0@-P$L M`T 0S 8pW 0 7/@P Ѝm$@ Ѝ( $0$ 0 ]"08p r T0M 00 0Ѝ @-Pp`'$t@t0@p@ ᎭU  @0 'Ὕ$ {V  0`O-$M`03H0 0" 0P0t 3ʿ0 00Pp! B b07<  @ BU^PE @ 0Q4BL3@0 MTT MT   ^DP!q!@2 Q   "  R  R  \00T3`00 01@000@0@PU*$Ѝ@2 0M  00P- S@0^^?0 0`0  P 0J ZS0 | 0J ZSx R @ \X1 0000 $Ѝ6 F5 F4 F3 F01 00CFs0S`0`C' F& F% F$ F0壛0Ps 0 Dr Ro0\  @`~ \v\f\r\s\0\a\b\t\n q  QA-@p`P ፛P=0D! D?o2]R0S d0T"@=0 !1 U U 0 P0 A A-P@p`)P.T T ! DI632 0 A_T 80T"@%0 !1 (0D,TSl O-`$(p 8SM PP 0p0D1070$0t1 0x10 ?o2V0S 0S W w@0P0  0P0 [00 #0@ S P@!T- U T 0  1 #P00?{ PPc@T`P @  !TP 0@T0P00IC1S@1@! 0<0`⬙pPA 0  0!0S V <0 G0CPa  5* 00  R  5' 0(0  R 00 00 00 "00@\0000S \ PP@T`P450%00 @U5%0  LP* W4z$0  TPX4$0 4$0  0Sx4t$t0 ` T# `@T 0 p9/P!00͙˙əǙ#3 0 D1 30 Sߍ@@\ 0S`(O 0S,0  = VR U 0 0@04p 0`0 p0 $  A aɠ4ʌP p  !PPPPU@ $P,P U]*   0@2!p*>) `. 00 0< ٙp  al (0~s(@  20,0T0 0S0"7000PHFD{00, 0 R00(00S(0 00 00P4p 0S 0SV W|1x!x0 4p 00IT1$ `@,@ s 0[P Y4*  (0`0S(0 DQ XP T `I  000p0'ptj Lj i Ďti p4i 0h h Ѝh T e L@- M@ (t@0@ 80 0P@ 0 30 Ѝ@- M@,  (@\00 @ 80 0P@ 0 30 Ѝ<p@-@QM`P0 0 `PkЍp0@-@RMP0 0( PUЍ0-M0   EЍ-M $6Ѝ-M ($'Ѝ@- M@@  0 D 80 0P@ 0 30 Ѝ2,P@- M@(   @00 D 80 0P@ 0 30 Ѝ봜d(0@-@QMP0 %0$ PЍ0ܛ0@-@RMP0 0$  Ѝ0耛p@-@Q0MP0`0 0$  `Ѝp -M4 0 xЍ-M  gЍ䌚-M $  VЍP-$M  0 0u$ЍO-MM9n S`< 9Ap P@0  @9p IBIT`p$p `T P 0 ST U  ܍Ѝ R U  jPP 00H@-p@-PP@ D!!!!@B0P0 @p0y 0 ܁\ A-`P@P( T1 $0S:0@@T(0  0 E R |( pt0S$  0 0 aTt ?p0p 0 V$0S%*T( pL0S$ [ [ Ȁ@-PPM@`q ,0PXPH00PW0: S Se  SЍP P 9̋P pы`P@0 ``\0@D`.S08<@ ЍPUP1X0000 !1 0< ` K0 0H c L P(P P 0%,0 1p,00,0 P , 0 |N ts@sM LssT|5p@-PP5 0S %#L R6@T@ǒL 0R@T @廒TP 峒,0 ᮒ@p(0p@ T P0P 0X n@m`݆ፒV e`K $q(qA-PP @TQ ,0,NQ Q% R ``@T kL0S 5S0T $4 0d  BQR@' @D Q\ 5`V `BV`05,0$ P ,0<,0@`V   <,0` V`P@,0   cP@ 50 5$ @T 0   0S00 /\,0  C ^00  @Q"U2 0d Tn@БL0s ,0 `L0SS 5 ,0( Pu( I,0P00\p ,0O/P W@ ` @0 0+C@gS (P/ 05 PT,0 Q<೅p(6 505F,0 $0S005@<@m(峅0S 嫆P *,0 p( 505K%``!`(呅`0 5$ 0 5$ J xp4p4H ,n0n/.Pp@-@P T UUp 0 pH "D0D 0p , (0( 0p E lkE jjA-PP`F L'p@,0 $5 S9 S@T @T V,0``<,0L0S00/S , @ g00 pp@ T00 P, 1(0( 0| ,@D xi|ip@-@PPP 0P0S 0`00Sᐐp@ۄ(n(k(i(儐$0B 0 SxpiD i$1$0A-P (M`@P @Ppp 0 00@ P& 00C S&0  p0 0 0 S0;1:(Ѝ 00?G0?G  "00(Ѝ0C tC \C 0M 00 0Ѝ|p@-@PP P PpPp0* 0 8XB `gp@-@PP U p@P0BL L0 U40C0 00 p@YB ,gYA gp@-@PP U p@P0BL L0 U40C0 00 p@YpA f$YHA lfO-PMp 0GW"S00` 0v@-P-TPg +T@`0> ǯ  0 0  P +  Ϡ@00Ds Pa0DSW0DA0DS"70DWu X : \R SP 7P"0 00T; W0 0 p 0 U00S 0 rS 0F0 Ѝ0S U @0` 0000S   Ѝ 㙉 㙙 p噉I㙙A p XR 0AA B PR `@P0?L L0 RWp ppW (@`> 0@0M0 00Ѝ30@-LMpP`@$0  00P LЍ`0 ƏLЍC-P!M1M `0p0猑0<01 @PW p1 0S $P(2 z  P* n6s0@R P $PPP) 0 0 < 30*ލЍ u>i?F㨀R 0 P P0nSPP0S  o@lFPCPAP(E(`ꤼ8Pp8p@-``@@ቂp@  P@P p`Ꮒ`p@-@P @(0F$ $0 @hI,; ``@-M@ σp 0: S  ]p  HЍ00ЍO-P-$@3,M00@ P0pST1p{U00Sy00x Pe0P$0@P`0 U  0 *M 0 @Pw `FP@` 0M  p P@PE0S7 PUR0  Y*0Pp R  U T 0G U@PP @Vh 0`0D00@ @$0,Ѝ0 ႍ00 0 $00S$0p0P Q 000 ᵁ 㝁p : p @ 00 001[ 0 p0 0 0 S 0S[ 2P p 0 S [ .L0H H0  @ᙋPP p,W7 \\p@-P  @T @ T0 0pp@-@PP U  p@ D0:@ @0 U(0;$ $0 [T6 [[,6 [/O-pP M@`0& X. @T fP @W P51 5*P @ 8/P  00 UWK:P PU@ ЍD0r@ @0 X(0s$ $0 wZ<5 ZZ5 ZO-PLMp@< [ TW< <000$0D P [ <0Sw 0WPD0`p00< 0G 000p 0 `;/PppYb* 0 h @( `P  R P`p,004P`Z ;/P R ,0V\P5P1@1*`Ip ;/P R <0  W@I 0@@ 0Y:W0@  Y:p I 0;/0P  <0  0I00 p' R` P0S <p00PZ0 ` P@000SCv 0 0` F Q0#03Q0SU (p, 04P8` Pp ;/ P0 P0R` pp`;/ PZ P W 0X$0 S 0 U 0 EU B  3  S0 0 SQ1:(p, 04P8`0S"*$Q R0B 0C0 0W00|@D 0pS+ 0Pi< 0 t`<0 <S  MLЍ <` UE W 0L0 0 Y ( 0  S``V 0`S`jp @@pPꊠ@ W[` ;/ PP @ pT00 510 *pp `;/ PPT: ` 0PX$0DSa0 U 0 EU B  3   S 0C 0 JU 0 0EU0C"030 00c   S &0 @PCUP00p 0;/0 P0UpJ p a%;/ P`pZ P000 JU0 0EU0C"030 00c   R 0Q$ @0JS 0J 0Q $0S 0 Q 0A A $0` S 0JQ 0  A<0SD  `00 P`( <0  0Ip'0 0W  dPh `R^ '0 0} x0  0[_t yp0p  0UX &T0T 0[00* LPP`* nO4* OO * OO- M00) Ѝp@-@ PU 00S  RQ Qp0P 0  P  pD0D 000Sp@-@(szP(nzp\pp@-PPM`% @T@T T0 Q 0QP ``0`P 0 RЍp0i 0 ,xL( Mp@-MP@&PUP`0S$00500 00  ~P& p" PQ! 0 00CR 000S 0S$0Ѝp00`$0L0L 000Sp@-@(yP(yppA-p`@PP0 00S (yP   (y0S tP   0S `(y0S 00ꐿp0@-@PMP # P y 0P吉p@ @Ѝ0h0 SdP(0<$ $0 W 2$ J``1@- (M0R0$00< 0SQR@ 0RSA!0 0 $0 305(Ѝ@P0@ C  (00 $\0R0$0L0S 0S ( !0$ R0 @P <0 0 $0 30(Ѝ@ dȽd$ # 0PX@- D  R4   @Hh0P@-X  S H@ D t0( @$ Ի( >p@-P˃@P 0 P0@pUp@-@PP LPp P3#p$  0  0  U <>D>10O- MZo @Tn p `P P0=S\ @PT[] A@ZP0Z03 S@@@S*Z2 81  0   `+ 0S9a  D!n 0 0  Ѝ0Z   RS@  ` 0S a1S  Ѝ PPꐰԖp@- @u,PPp 000pplA-PPh`` p\@P 0=S Tp (0@00(,@-u@PA 0@0R,@-u@P3 0@Q,@-u@P% 0@Q0Q!-!0!1100 000000 0#0, 0# 00!R0Q0  00R00p@-P@`%1S 0p 1" R  ! R    Rp@P@`%1S 1 S  \  1   p@Q Q      p00 0/A- Up `QU @ @E7/P@G-Tp `AT P PD7/PX PPHPG-Tp `AT P PD7/PX PPHPO-`P@UpW 1S @P@E  7/P?@P@0@@@ģXB !Q   . @J000 00Y000 @0@S00 PT!R1S D o 000J@@0@@@򐫁 @@BJQ0 @-@"P 0 PCQ0 0 R QP @/ p@-P`@T0P \ 6 R6  0 T00"P ^[0000000000000`001T\pp@pR* /o" T 000 2 01T  p`^`  T V00pp@HQ `T ` R0\00 G-@ ⦀pP! PX0PD@T$l``PX I0@XPZOr(O#s(0yTV  _00 C0?O 0LD.00@-[,@@0@P0S@MA-`@P吀@_}-P(p0@aaZOr0XPOr(0TTaV0( $0 00(T0p@-05S P sP0SZ sX@ 0CR\rp@T P XP@rꈉ`GLGF/p@-@P $PyP u$sP op@w0M 0 <D/h L/p@-PP@ T  $0 !0p@/L H0H 0 T, (0( 0  .. ..p@-@PM$ $`0.  PU P  P pp(GQ00S 3/Ѝp0 03/( Z$0$ 0( H `. --C-DM$` 0RP 0(p00@0$ ]PP  0(0V,00S 3/DЍ Rv0(0,003/ ?PP A-PPM@) T2 0S Ѝ $@0 P 00 `pP gЍ00 pL H0H 0< aT, (0( 0< V ++ ,+O-pl"`h2}M 0(0108 PP @Pr 200;q20 RE 4q1$@ 0 01 0 u 4p\p8`D` 0( .,0<\( PS H003/``[P%  !0 0 1 305}ߍ          C  PmP P||Pm``Pm7븝ġ@P(  )l )H )P/00/~P@@l0SZ@P VD &G-`R p@P8/PP @V!1 G-@Q0MP`000R U: U30p )P00 S0 00 00tPP 0 tPP  t0SP !1 0 0 307Ѝp.00P0p eUp0T  sPXpp PPsp 0 P@w0 00sPꦬXt/ B/0  Q  B / 0R B %3 % %//Q0 / 0R  B   2/ // 0R  B  2/ // 0R  B   2/  // 0R  B  2/ //0S :p@-0C@0 P 00 0p/0S :p@-@0C0P  00 0p/0 $00 0A / 00$0ꔆxp@-PP@ T" aP 0S Sp@a_Ppp@_D0@ @0 tT(0$ $0 jX    p@-PP@ T ^aPp >p@aH XD0D 0 I, W(0( 0 ?0 X   p@-PP@" T+ Pp ,aP 0S SD_P p@>_p0p@/L wH0H 0( T, x(0( 0( ,  <p@-@PP U  p@/aL gH0H 0< U, h(0( 0<  h X0@-PP M@ T# ^P Ѝ0`P 0Sp0 0aP L0L 0L T0 ,0, 0L  $| lp@-PP@! T* 3 `F0S p^P `P ^P ^P p@^T P0P 0\ eT4 000 0\ Z t dG-PP@F T  R# R `V$ V  0` X%TqTp 0l 1 R R/ 0 00 `V00!`V | 00 F0R#  !  I0 0l  0  ` 00 00 0000 0` L 0 d @-t/ 0SAS/0-O$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/p@-PQ@`2 V' T ^ 0S^  S 0RR00p@@Tp@0;< <0 s(0:$ $0 j|d P@ ,C-@!P1pP M`0030L TA A< XP7 `Y 0S `!X1 0 3 30Mߍ(#@- R@ R0 ! _ p0Sp  % 0 0 0 0 0 0   6  RP0 RQx  O-IM,M`p$@PPJ d4 I 0$000 pW W0 $I4$ 0 0 30Iݍ,Ѝ0SJ= 00SX30 0 > J=000h0x K#0 ?s0ˊ 'J- 0S 6VU0  SU S RMJ=0003嚏 0 0000H0:0,0YSP @,VU  W3 0Sa0S  0S0s S0S RJ=0  J=00]WM O<  VPa 0SL jh03?Q #< J=P0h0 K<0K K0 K K K Ct0 Po J- 0SJ= 0 qS SvJ͍0 %n! 00S^LP P P J=00W0  yVPJ͍VP $Їx@ `l pO-`$$@ 4M QP@p0DH0000#0C S0 #3 0 0 30Ѝ#3 0 0 30H0 D@pЍOWX] 0? s08# উpPT0S0SG # ?s0qDPT7VT00QWX000S RX  Rd R2YP 0SL"0 fT@@O 00QWX00VT; !0 K X: Ypp 0┡唱P1 0pY@D 0   'T00? 4!0 piT 1i #Y=P쐟0P蠟 0 pp  P030#?pW@D 0 D P^T[pF\  x4 ؂xX *!T 8*G-`!p1FM 0010% P@p P  RW P Wv`ov` 0@Sp0 0 0 1 302Fߍ0 0000?1H 0 0 0P Z /r RX 0S P 0 2ꋦ~}A-@ 0P`p0 | 0P Ip@-MP`P@@P@T 0S  R0S @CPPЍp<PPЍpp@-@P }ppPPp0@ 0  ( 0S/ 0CAA. q.S .R Q P-S Q P_S /@-0 S?RN0\L 0RF @PTN 0S`U DDpWe U_ ^" DPD`VQ S`. @@@0T)\ R /  R 0 0 0R0C?o20SJR 0\ 0R 006 S0 S 0R U. ^2 D0D@T 0U& ^ D`DPVS` D@D0T^U ^ D`DPVS 0R`V^0Sp@- Md0@0."'  P 0R0 0S  R la  haR 0Sd .P 00 Ѝp 0S S0S,  R R R  R/@-/ 0 S /0S S/ 00S S/0S/ //0@-@P M 0S PP 0P_E@0S0S 0S  Ѝ0$0n 0 hl @-pQM @`PQ Q Ѝ0SSp P*pV0S" S  0`S Ѝ Ѝ00S S<0 }P 00 hzp@-PP`@ V T! 0p᪤Ppx t0t 0 VX T0T 0 T8 404 0 \0 < O-Mݍ4ЍS60 0 0?s0`So_>pC80 @:0 0@[P00  03/P 0&,@&<808 0 SS0040R0SW B R@p$pv0SB *p 0(,P Tp*0   C 0[PPf00  0 3/P] P[@[[Z `M40S?&<800S !T? `[ [[z_4 0 0DZ@P200  @ P) q`P% $0 D0R 4 4SʀZ 4S{ 000`0 T &<800Sf 0D'TS@pW0(pX,PG Zx 80pH ZCPK軟 h@`I 4sZ2 0 00E   RP $4Pr /r P0S S000 p0SsZWy 80LE0S5 [00Z0020 0&<800S3@ ᷀@PV 0 8(5$%0 5s (0SP #0SrZ00@ $0R }TA TTeT @ Ⴠ@PV\(0S `<0`PC80D\H X<0 C,0P? 0P,0(00(040@ZOt00S000a@0z_4 0 0Y@P00  03/P X00`S  @@ mmhYPg0000S 0R $RZ $R 0`}O-SMP$0@4 00D103p`P /ppP P$0X` 0   C8000pS0  PO 000 JPK @@PX 0  9Pqq@#|3 0 D1 30SߍY 00IwY00 Q0 0 .Q0Q RS% d! St*+ 0 PMqKq @S Rd! Sf*.[ 0 PD < Pdq 0 DDQ0000 0000 Px0=S Y0S# S S Q 0 Pc0s70SS0S Y000000  Q000S0000 P=X00 0 P3X.[00 0 0sx X00t *0 .0G0 wPʾX000 DDQX00UpX00Rcad O-`MZp 80 SP |@P> P\0P0 < A C0 BS L= S S*04T 0 P00|0PPp @ C d1S dPЍ 4 P/PVURVX00SXP P P4 p'P xQPtAp0PP@kT@m_ ` `  " $ & (    C @0 R  0 CP  0 [ PP00++  @40<0 C0+,0Po U@d1 `S lPUZ  0 0S  ! hPO-p"`20020) 0P ؀x@☰0" $ `* ,  H D K   W 0S0S  `% 0 - "2 Uߍ0 P 00 RS S 0 0 0`P  0=`$@0 0,0`(p@ p$Y i:92 I52 0Y00 S   S  R  R Q\  ^ \Q/o" S R0S 0 PQ +0 0S Q0S %0P$0 堜PG $ 00 B  `D0PQY( $00X $8*  0`V 0 \ 9 00^ Q  P V \  R R  0 0M p/ Y ` P 0S   0?S C" 0c6#PY  ^m \S㜐Q^@$T(p0S 0` @(p ,p$ T d:42 D52H 0SE0 S > S PR  PQ @0 X0 0`P`&0'0|7f 0ZX @_X' 0@S0 `X@T $PP@P mlT$PX@T@(pT v W 00 0`P0 P`UV^ l0P 0X tXp  0!PPP PPpTmPXPG l0S? 0S l` 0@%5 y/0QRSP㜐  P  P \?oR20S ` R㜐C AP\<R PJV `$p,0PX0000SoX@T0 4$p0,0PpP S 000 P@T 0S00S`9`7 0 `kP Y 0aP-y`0 P R 00S R00Z  P6 0 P\ 00SS㜐R0S #c3 0}/ 00j4@$8T WP @T@*$@` Rk 00` ( `$P! WVIHhF0DP< , @h`R0@8 ttг ( W V@`Pq @2P6댐 pW0|0E0 t0 0 $0( \phpn !w`P ;_P60EL ,0LW`P00E+,P|,0U SV S ^ ,@Q E 0@03 P,@ Q0 QW ; _ @p0` 2$00G'0 0S  00jP@P P0U 0PjP0U j0$p`,0Pv,@E~. > L I L`P1x00x0 bj꣘@``$@P P0U00T0PLjP`O-PLMb Yk бPQ0 @P C   `P00FPG 0pp R R R0 T@50P p R ((0( P00 V pW X 00  XppWV$@LЍTT hP0P 0".Y4 i000 0".Ծ̾Ĭ D G-XM`@}P pPP@0 E0     0}P 40S0- XЍ PP i  0|P i8<8 /P 4PPvQ 0  O-"M2*<* 9j=2+X |z j| J3**?J0VA$Kr~A$16zA$0*4*({4~!"r%kz!"1j5r!"7j5 Jva&)C*0V7 8N(̅0  0! B 0%a0,@0#@,0 L 7@ @$௏@|O!dE #.2* ㇇Dta& ,80Jlʎ$ !0 FO8 0.00#,0H IFc5p 8` *pa& 6@@!GDKHꬃ@ @  .x)HOLn # @*,$x \Hǎ @: @$"@F .dE! , 㘽O   * $yJj  .$ !!㴹D  ,bE (FOlŎ@@ . !@C @@L@ @,@` @$ @Q^BK !  `. ધ 㶩Nn $ , ]/MlƎ  .! SD@ @,@ @$ @㡨MK ! . ȫӧNn $ , BlƎ  .,! ֧7L j@,@ @$ @դOK ! . ZDn $ , JlƎ  .!  O @,@ @$*H @٢oF K !  . n$ * BOj  , qHlΊ @. @$ `@"FJ *.( Ojn ,! D㾤J  $* Dj `@. @$ @`O J !,p KlȄ* .8`B  $*$Nj@, !@DM@ @.@$ @@ dH*. 9 M !,, ۦN lΎ$ *Aꪌ @. @$@eLdH ,!D)O   " *Db-  . Jl˂@ @@$9@ LO@@p !I[EF@ 00@0#0 @, /H Jc= , }Ob+ . HȂ !OF<@00 0#0,Oc=   " Jjb+ ,DȂ !SO`00 0#0c=@5:K0   " 4b+L B ,0Ȃ 0 P0## +N ` H` 0UDP  DTЍ@-@P  0 'C D00, ,0 #EgܺvT2$4 G-PPp`5 W) 0!ӑ00@@i00"V>0: 0iS@I"p ` *0V@@p`F GxH D0D 0 h, (0( 0 ^0  d ! 1 p@-`P0M@0 00' T0 P  !7R8 bx b(   0 0 0 30X Ѝp@` \0\ 0 T@ <0< 0 {-x T- T̘ (C-, M($2$"0 P00p  ` 0R @  0XS @@0 T $. 0N `!P1 0 0 30 ЍT  0 s0Aa0C80BS.R ^V* 00RP 0FS0 S S^*0X >s000@^0 8< 4^*0 8<,|,+- MgP ЍDD!@- 0(M S $ A \/o"S R9 S Q R L 0 0 $0 30)(Ѝ@P @ B  (  0$\ S $ L R \0  R ( $Q C ꁑ *)ȕ | A-P!1`P rMp00109 UA @^X0pA00tAS0O-T2?O 000TAV aP5  0 zpP& 0@mbP 0 0 1 30 rߍ0<| |0 Ud0=` `0 P b00P 00('  $ȓ 00- $  M  Ѝ' -- M0 0x ЍЍ/-8 8- M0 0   gЍ Ѝ/&p@- MP|@`x0@t P`       @X@~PU  Ѝp8&PP L1! @-`0M000Wp P@   LXp V@ 0 0 0 30'ЍVPpW @@T PU 0S P@^TY00@`%% 0p@-P0@ 0 p0 b(0P b(P,Pb 0t0PP 0"P 00 0p88/sP 00 0pp訷؟ 0@-@ 0 0 0  0 0 b 0 0 00@-P M @0a 00P 0 ,A?o 0 2c Ѝ02 00 0p@-@P 0U0 0pp@-@Pa0PPa(0Pa(P,PpO-p0Pg `P` @000 S S0 S S hPPO 000 P[pp5 $y@P 0P00S S S@ 0AS A`Q@P$  P0S0000`P  _`P@@PhH O- M`p@,0(Sx: (T] TppU 00SQ 0 RK@D @TPF 00SB0@D S@D P+ T0V  0@D !0@T0PG 00S#0A S0偠0 0S000  0S% }p@`0pp`(0p`(p,pm@ Ѝ_P  (,@d(0  Ѝ0 00@- M@P   p P  Ѝ00 0 $$ 0 P Ѝ0:p 0$ $2 Ѝ0O-PTMf E,Pp@0@ pp0aPe,^`Pa 0 pp#aPV,PPU 0@Q QG QR QD pp0U00S y^P/ p 00 0@ ` R  R2 R[ R 0 @U ` 0 _ 0JX0M 0 TЍ   @ QA@0U P 0`   A 0 T'QO-_p8 P`mPV<] w"( 7[0` @w$0$ X`(0,`2(-`P p[(0 # 3X, `0!(-0P ppQFf&``V0#03 U0S `V:PV Z4XX1!030#-00N^@%000X` S81P3 P#S41PE2s2PEs?SXPEh 0d4 E0:0r ; 0Z< S81P3 P#S41PE2s2PEsSPE0j F0 E080r 9 PEPE0 j4U0 8PPE0 h$U4 :P 080 4:0PE h0 @-pM Rp( @|Sp+ `0v00 @ `P Ru l0 0@P ЍQ00@Ѝ2SQ / p@-\ ,P@\ \P Q :\ :ApU00pP00$G-\MH @P 0( Q04 :p;`ȁ C$:9 - 9cHR910垁a @8nj<Ơ ` R 0008` <9P00 @A4ƌ<ŠaЍ 00!00 0 0@-S@ 3/@fS@-] Qi7nIࠑP*i7nI P@ Np ^ @ `@D@P V% @D BD$ BPE&"PE@D"V%@D BH$ BPE""PE@DQ%@D Be$ B'"^ r N $`PFPEV%A B!B E BA &"A@!@ B BA!" A@!@ i Q7nIP# Lp \ @ `N@D@F$N B. B@D&"@DN"F$N B. B@D""@DNQ$N Be. B'"\  \ \ , ($`P\\- \) \+ `P^^ NP\ \ \ \TP~XN `Ptlhd\X | 0z y @-@P  @K0/ 0 (w`y 10 @-0@0 0 0L#d.\ 0@0\ SC@ R P p0  0C00 00L  00t@x `y x O-pl PlL MY' u ldEa dP0Ve0 aQl \M@l Ѝhx D2Ÿ0 A-P 0@ @ `0C0$@i 0@b `0C0 @E 0@> ` p0C0&.SI 000@000@ 0pp@xqE0Cp2Sp X 2S 000 @ @  @0 `00PU  0R408 00i`1S   ;`1S0 y0 0 =PJ0 0 1P7P P %P$0 0 P0 0  P0 0 P0 0 P0 0 P`1SxYz < Pp0pW  0R 0[ipW 0pW  0Rx 0HipWf 0pWa  0R0 ,05ipWGpWD 0 PS 00#i`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P 0 0p01 00p01 0w0p01 0lxx1p0 bXL htЍ tЍ 0 M10 F0 ? 0 80 1 0*0 #x0  Dt D,x t4 `4pdD$Ď @-p0AM M`@0 $0 40 0 p>PP0S K@ 80 0 4 30AލЍ.I 8 0,@- M@ p  PpE>`PaP 0S <0000 Ѝ00S.S 0S Ѝ4E4p@-Pt AM `0 0 $ @P 4 ,0 0 4 30Aލp8 p@-P@`Q  @Q wdPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P 0`CW00 Ѝpp@-@MP`0S 0 @S 0S@V00ЍpO00@ 0PV00ЍpЉ0@- MP0@0@0@T  0U Ѝ0l0 0PU:H@@ Ѝ0840 P0@ Ѝ0d @\PQp@-`M x00<@P 0PU  0VЍp_40P 0`Ѝp @@ d 0@- MPm0@0@=@T  0U Ѝ0p0 0PU:L@@ Ѝ0<80 P@0 Ѝ0 ć̇0@- M@7 Te  T T 1 D0R   T8 2@TP |QTP Ѝ0TM  T/  TJ DQ TP 3^41P( 0@MT T: QTP PTP PTP P TP PPPPPPPPPPPPPPPPPPxPPpPPhPP`PPXPP_ xlD(<ć܇ȇHLHLЇ0D8d0@- MP O@P Ѝ0 0( 0P Ѝ00@- MPh0h@0@B>@T  0U Ѝ0O,0@ 0P Ѝ0x <TMp@-@ML `P 0 Q@0P0<00 0. 0T @D G000T H0 0 <0 30 @Ѝp@Ѝ/T.0 B1p  O-MP`@PP  p0 Q ЍSp SRPP 0-S  0  +S 0XP 00C<,0d .S 0 @QT.‖ 㘐@@✒)  S #3Q#@ " 0!   R#S # 2R 0T#+<'(0+8 +)(0'<0'4 0)< p 0)4 000Rp 0T Q#@ "  S #3Q#@ " 0!   R#S # 2R 0T 0T  P#@ "  S #3P#@ " 0    R#S # 2R 0T0 0T 0N 00 000J00 0A| O-@Q dM0 R  @2/R>03?1|gO" \ ^mnb`AS N P _.((H<S0c&sf~e~rHpl W E T -b AE#D((H'ᒾ  L>c@L<@<0d0c@02gࢲ"X ;krǁ nÁj뿁ZX 0H Y J XL ,0@000(0L04 $0\0H p 0T0`0<00P00D0BZ SY SX SdЍ @A  \ @R@0@g x  0 0dЍ@0Y0 0X H~~```@-@OP 0D .R S0@*ST .P@Q QA.@P@@$  0  0( ,T }~@-$MP4pPpo@^ d  0w# x'w;7  zbPs$Ѝ l}C-`@ MPp耟@POP @U H`P@Wy@ Ѝ @P@t0 0000 5 0P !-0S0Y@OoB@#h Ѝ0p@-#@@0S#0@0Q R#   =0H04S P pR  QR 8 @0Q     Hp@-@@P@0P`0pp 0,0p@X0P HD D p@-` P@0pp0,p@:L HHA- @@P`p0p0 A$ HC-P0 M`p0sp@ H0  D@ <8 @Ѝ 9 HxC-Pp0 M`p0Ip@ (0  @ Ѝ 8 H0 00/p H0 00/P H 0M 000Ѝ( HXA-pP0 M@P`0 p 0 pZЍ H0M 000Ѝ} HxC-Pp0 M`p0p@ (0  ^@ Ѝ 8d HC-Px0 M`p0p@ 40  0 e@Ѝ p8 H<@- @  $M0 ЍT HH0H 0p@-@0pP p@)H8p H8- , M $ 4  Ѝ H R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0 Mp@Sp` 0T 0C0 ЍL0H 0080p 07/0 0 {{O-Mp`@PpM WC*00V>:Y ` <1 80 pp= `P 0 p- 0 p& 0Z p `0 p F0?V0S0 0 AЍh0 pp 8000000Ѝ?{{?TzO-Mp 0,00Hk= 0P=40 @P U *( ?0 00>08/0`$PEHk= 0HP=00P@>d 0P ` 0P p , 0`%p =000S=000SD -=0 0  BR  p  R 0S .S 0S 0S00S.S-(=< 0-< R- @ C+A0X 10"3" 00;A0000;A020 0;A====C;+A0X!1 00=-0;A>A C0==C;u=000+S =<00S\Ad 0@ 00d`P0  py  0 d T0  pk 0@DK 0T*P `pPY D uttu@ ssttgs0@ rq, xdp> $q`o(poonnl`m ml9 9 klj8 T7 6 `6 ggdcc|bHbLcapbba_l_`,`4_^]]^t^d^<]O[x[\P\(\[( tZ' @Y ~WW@WUTDKJ 0d  00 0  p<0 C0P0DK 0T+*4qPp\O `PP 0$VB  R @0 Y$ 0d  0  p @T0=<00!V5U5E?C0 SX!p@ $!p=<00SG 1p0d  D;20g P`0  p| <04@C0 0 P`:Pn0 pf 0 P`)P]H=<00S -d3< 0! PJ-3< 0$0d  030 ! [p{4=<00Sl -3< 0=@ <0 n O1@L1@<`( 0Y00Dd40 P@0 +p =<00CV5U5E !?C0 S|0 p7=<00SU 0d  050 ! p `VDPD4 0R;P0`@   D$0=H 0p 0a% DWP *( 50 @00504/$0pGV= 0p0HD 0 S@P(0 p @P<0P`@C4 0p 0P `MP0 py 0 P`<Pp0 ph 0DK 00CSk 70=<00S0 H[= 0@ 0$T` *( D7h0 p00707/=P 0@D`d @0 H[070 ! Np( 0DY2*w`@p0p PYD V 0  .p `0d  @ 0  p `F@P 0Y!p/@P<0 C@0PP0 p PDK0 0@/H/@ E7 J= 00P@ p9( x  009P 05/P`/* *J@1p#00DK0Zv !pp<0 Cp0VP, 0 p LjDK`P/D[ d 0 U 0  pl P/D[ 0d  C 0  pZ /P /` /;d 0`P + 0  hpB H=<00S \+0 S~00 =<00S Kd 0@ 00 `P0  Ap 0pd  00D 0  0p  0 d 0  "p P< 0DR  =<00SK /@/P/PP0@@2 D;<0 `p0 p <0 C`0pPH <0 C0P0Dk 0PCUpQ@p@T 1 W2 n0d  } 0  p=<00S .@.p@@ >2 0D_ P`0 pt 0 Pl N0 @Dp` 0  PY 0 DupO 0  @0PG 0 D;0bp< <0 C@0`Py2=<00S 0 C|? 0=<00S<0 C0P0D 0 SW C* *J 1#00 Sl!'pG0 H{= 0` 0"{V@ *( ?0 P00t?05/0- p`FH{`DD!p0 H{= 0` 0j"MV@ *( >0 P00>05/0- p`FH{`D-00 R -|>< 0-h>< 0 0 CP>0 0 C@>0P$0 PD[ 0U:=<0-=< 0P  `PV V }pP@ 0TE0 0pa 00d0@D0V0 ypR-P<  @PLTT }pP` 0VE0 0[p5 00f0`F0T0 Mp&+DKk0d  0  !p )+0d  D;X400  p <0 Cp0PD P :B  P`&P spP@ 0TE 0 0p 00d0@D0VD 0 p`3`#0 T!p 00XS: 0ST.C+SQ/+! ` 0000`  0C` Q70V0Cs 00000   0 C R7 0 0C20L0?H H0 40>0 00 ꤔ  6 6 6A-Pp@JU`, T08 @W``W 0 PE.pVp P7000 2000 S70Q00 V00 g0  0a 5x5/to/[\///@-DM` @p0 0 < 2 -0 RP000000C0< ,0 0 <0 30DЍk 5, O-hhH Mz zJ0 - @P<%94BP  B,@h3"f'*g* J 1`JH*ZOWVoX= 0@Y$* 0 Sp: [ @B0?R0SJ  Ѝ  0 H|p# V0X[0S   000 00000S 0WYp@ D 0 Mp WV  0 MAp X <0e8 80  Ѝ ꘐ  42( H2A-`pP 0S- @mT 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@?( 0 $0p@- M@P00 80p k$`p Jo0 (0 0 8 30ލpzj` 0-@-@R M00  ,LPP * Ѝ@Ѝ/ m+ Ѝ@Ѝ/bjPRp@- `@ PwPiP0 ?p@v1W00pPRp@- `@PUPGP0 ?p@W1500pp@-@Q `P5P'P0 ?p@1100pp@-P@!1P  p@ p@p@-@P 0PS <0S P 00pf00pQP@- 0R R  S00p@-PP Q@ @Q Q Q AR00A32 :00pP @pP Qp@-@P PP  U J @ W T 0?G0jS*k&0B:PV + T ??GRP0s  p Huuuu[uPP    ! d\*xPH Tv@P| \ Qd00`C00A`R AQ6`s (  w~ 0 S1 pB01` ZD0 0D 0B XSXD;@   D 0@ XX 0 pR  $ pQQPP?Q  Ӓ.0p@D0@ [r (@ D0p@0@@ T(@HX~c @TpgnP 3v@P HuP,y Hu,HvPP8PmvPP AP= sT cVP0S^\0S ^ ^NNH^G GZ Q 4 jZ  R  {:S03V:gH H 0 Qk& B AP{{ {0 /G  RP {P0Q00 `8 ZH8ttt ttO K (ꭋ p V HH0S 0ES 0SD d 6lŸd 0  0d0D 0H0p L Bp0@ SZ  0Su  P  `  ~NorK`D@*sP |D00CD0!sR PD00D0N   P5LT - G{ {{ R??GQp 0  ^ ER   D0B @   㒳#  {g ` $ 00S0S:0:g `A5?? $( `@hP@, j@<@8  `c NWp 0 S0 0` Z1 D00pW 0"0D 9@@0@$ J   S\8 0%H \PR 5}rHsL P0+5T@ @BP+@  2 < ^ TPUJkd^ ^4^PK@d7TTTP @P@ 0ES0P008S0S0SM VlH3s1s/s -s+s<0S  0?G\ * 0S8@} 0%Q<d  mP&46% {TV (0@8P Q SP0 <P p @`-VP0 S]T0S RY/G 00jR0SI:k60C:P H 5?55??P9$ P080T R0S?G0kS~0S0SxCtPu tPTn<0S0?G0L kSJ7S Hrrr rrf$tP btPb<0S T0 /G jRQ2PQ S*= <P p@  4P@P<PQ! GjQ!`kn\ S [6C#::T00P0 SP0 I|??GP G0TP0 8  @  0M 00 0Ѝ p PP1?!0 "p 00D> 2@00D A Bs QR 3p `> 00XS W pp p00XS W& p0 0> 0 00BA0C QSWpP pWW 0@ p pp0@ pp~P, 0M0 00Ѝ[  r  Q0?0S @-^-- Mv ЍЍ/G-P`pP WX D00`F !R !V6  4P 0PE (膶`V PUU@@pPP X4 00   @@PE Pc00 W000@00T0BP P0 BW80C4 40 8 H A-P` H@H0@D@p q@U  U A0Y p@-@PẪ00C0S S u P 0` P㱪p@`u@-@P 㘪 0`00@藪06 0 ״$ - M?  Ѝp@-PP@ T 0 DA 0pD0M@ @0 ഴT(0N$ $0 ઴8 Tp ,A-`P@p' T0 W9 0S 0SP`; 0FS0 0 0 0 R G``0Q00 60 0 mTd a`0` 0 bWD b@0@ 0 W  d8X D , $O-p#@3OM PPd0 h`0410`10 V Vy Z.` P $30 00 [ Q!.PQP\.Q a :!ӥ!PZ [ 00:[.[<##O[0Q.SI Yg0IS00`0 0IZ 00 0W D 0 P00 `` h0 0C SB: ˴0  `  0 +00帵/00P!@1 0 41 30GOߍ:[ 0( @$000,70 00 0 `0P u P00 ZU00兵00 B0 ( 0v>4 <PPD U.Rz  :3P n[U U TS M 4R  $\O-`PM@p  W0p0 W0^( 0+P< 4P 000 00 @pupP 00 0 "P > Q Q0 `@V 0H`V:`F0V:\`FW @p p W`FF R-0 0 00@ߍ Q Q0 S S `   pPw ` Q PG PC  T:  @D R,P  0@RP- #[{0fpp @Y  `Fळ[  Kq꛳ `FW ] %  Z Vw P `p ` RW R R RO T* ᭟PI p(+@D Pm @P`V2 rP( !T;: `P  aP  T014@1:x ^0 @ 000 0R,C0 @0 @`jB,2 0@0@0 P0 `@P0 TDll1@-`P0LM@0D00E DpP0S, @.0 P' U' qp0 0s 0 f?P  + 0 0 0 D0 30LЍ??Pppp [@ +T@ <0< 0L ࠱ ZxL h[\[K P xA-PPM@6 p`p@T( X pp00  0?P + 0 Ѝ|pp @+T Ѝ>P @, (0( 0\ OYH 4O-UMMjPp, `*0: xU0爕0L50|5 0 ,0S 0 S00 4:0$0()0P00  0p @?s0`P WS#O 0<+0)09 0 L5 30[UލЍ5  00y`P0 $03/P  W: !2320<0o წP 0PP`P t00S  X ŝ` H R/@ DT L8\ [d*`P 0 C03@PY0 $03/PQ @ p W2 ( [4% R;< 0R S  0 S0S S 08P 0( 0S! 0S H0S 0PP( 0P`U*\0L0Q*@jH0`P0L@H0X8HQ 00 d PL0 W0Q0C?o20SO pZOp [XPH `BP0 0 00P\ ! R soQ \ V Spp0PX 50$0W  H0SX0 B@Gq 0SPSP B^Pb B@Tp `0S 0 00`@D @PC0@P0C`@S:Dp `@*L0X` C0 0CS:ְ0S40 @0 >@Pd0 z (0SC@TY 00@SV@ 4@``@,PK0 S 0B'RSB@}P zP 0P%D+1#3 0l ,0ST#3 l 0{J,0P08D000\R4 0  0P 0 : (0 ST00 D00R;*00P 0P @ `@0 CR00PS 0800@ePPp֪0`P CR00@S@P`@7$0 3/P ` }/T0(D 0T0@B(0Pw  D00 0D0D7)0 ,7PI0 xP0 F (0 S}H0S 0P T D001Q=*00P000SL@ Py 0$% x*u p Nύ 0 00J@1sGe t 0P `P@ 000Z0P %xe*RZPP W00(D@C 0T0<(0P D00 8I I H (  p A-@PMPF 0 S`06 S10p 0'PP 0  1 P; 80 0PkP! 0 `(ᇰV 00S S Ѝ0po(sЍ8 404 0 9^( 0 괯 ܵh3O-PPBM0M@040 0 00S0/ S 0 "2 0 4 30BލЍ耒` p @0vG#"0 68P@T*X,$ q P 0     ! 8{&@PG pPB 8 0 0@PIp 000 00000 0w`'V@ 0@ @IP Ხ00S 0  0@T/  `/ FƯ 0  ~' 0 w 0 0 `'᭯ 0 e᦯ 00S S\ ZᜯU H= < $t G-M`0pr@P0P0 V 0   0 pPqЍ 0 PP 0 0.ꈫ <A-M`pP=@P , 0P (   PBЍ, P00ЍA-@P M`Pp@Q UV'0S9 0S0S9 P`84180$! P <Pp0P 00 ЍU U, ծ/ 0 0 Ѝ0S ʮ 0 00S000s S 04 @P`8 404 0৬0,3 (h7 l  O-DM@P @$0h 4400<00 (p+% P P`&0 `PP ἙP ,0 0P0â RR RR$ 0 Q Q0 S S @  @P $3` 0 00S S S@ 0Zi*@ |@P 0S 00Q$0 0A@BA Y  9:I S4  0 I0ધ Y$:   TIr 0FD@@ P`   H  Y>`ᇧPU P` & & 0  0`!L1 0 <0 30GDЍ(f%J P ` .P=ڭ P0 0 0  0 0 G` P`@ 000%%  0 % 0000啭00 `S`P6 ܯ3 p@-M`@P 804 00  ɠbЍpAA@-M@ (9$  Ѝ@0[' + P%p 0;/qp 00P @ P !00  0 0 0@Ѝʟp pR P0 Q+ L WY  0pp>P 00 0 SM  0 00;/qp 00PP^ <PU;Ꮪ0 z0p ;/qpP0 q 00 0PUßR <0PUß`X0p] Ri0}0dX0P\OS  00Q\ <P800CPU0&Z "   RPLP0Pe? P ;/qpA 0000 P @ P !00 0Z 00 bP*0 S': PE u AJ 0C0~<PPT 0S  0CPß81G4!40 ௦APU0 Z 0CJP &JPP @0P 0000 00B0 0 04}00-D0@ @0 l0#  T4 t HO-P,M`p@PP T 000S000Z00$0` 0PPW 000@P $ 0R00SQR+XP `   0P 0%0  UPP`ʛ [XhV,Ѝ C$ R_oR  B0 S $ PRPPU8 0B Q: `PP$ RPPURP%X00S PD00P \[ TP|[  0P \ `PdPU[ @Tp [H S$0 ` Pd z oP 0S   00S S0S S ^ S@@T0Q00S00i0\#00& ^@ [ @@ S@ S@0h< <0 X0 y0B( Pp@-@PP` U 00 FGp 00p06| |0 0Ud07` `0 &0 @p 0TS00ꈄ ܌ -M0 3/Ѝ/0@-@P MP) U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0@0< <0 פ(0$ $0 Τ  0@-@P MP* U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0H D0D 0 , (0( 0 긊  p@-@PP" U 0S S S 0p@0/p0p@0/pH D0D 0 a, (0( 0 W܉ ̽ p@-@PP" U 0S S S 0p@0/p0p@0/pH D0D 0$ *, (0( 0$ P؈ ȼ0@-@P MP* U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0H D0D 00 , (0( 00 \؇ Ȼ0@-@P MP* U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0H &D0D 0@ ણ, %(0( 0@ ࠣ l؆ Ⱥ0@-@P MP* U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0H FD0D 0P j, E(0( 0P ` ؅ ȹ0@-@P MP* U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0H eD0D 0\ *, Y(0( 0\ ؄ ȸ0@-@P MP* U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0H D0D 0l , a(0( 0l ؃ ȷ0@-@P MP* U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0H iD0D 0| ઢ, (0( 0| ࠢ ؂ ȶ0@-PP M@ T 00P00 Ѝ0L H0H 0 ~T, q(0( 0 sP @$ Ѝ0@-PP M@ T 00P00 Ѝ0L H0H 0 QT, (0( 0 F꜁ ̛p `0@-@P MP. U" 0S S S Ѝ00 0S0003/ Ѝ0003/P 00S00 Ѝ0H D0D 0 , (0( 0 ꈀ \x` P0@-@P MP* U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0H D0D 0 ̡, (0( 0 ¡ x` PA-PP`@7 T- V= 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0 A0/CoP *L0L 0 u4 #000 0 k~ Y,~ \~ A-PPMp@`4 W= T& P R P P P @ЍPX e00@R X# ЍAt &0 0' ^0 0W _0 0 n P` J0SP@'88| | | L0| p@-PP@ T  ;p@|L H0H 0 ֠T, (0( 0 ˠ{ { PtA-PPp`@. X7 V@ T P  R 0 R 0\A/W 0A/ 0 0 0 0Xd `0` 0zVD @0@ 0oz lz \@z 0z A-@PM0P` 0L U@ 0pS S P R`V V V ЍW כ {0SPX00Ѝ W`" e0SPVA 0 0 h /d0d 0  ` Pp,,x @hx X(x p@-@PP U (#p@~L ?H0H 0 ؟U, (0( 0 ͟w w <|0@-@P MP0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0  003/P 003/ Ѝ0L WH0H 0C/U, (0( 0C/|tv dHv L80@-@P MP0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0  003/P 003/ Ѝ0L {H0H 0G/6U, (0( 0G/+0u ` u p@-@PP U p@SX T0T 0K/U8 404 0K/p@;t ̎pt t`p@-@PP U p@|X T0T 0N/U8 404 0N/ޞp@ds ,s p@-@PP U p@X T0T 0R/U8 404 0R/ඞp@\s L0s 4 p@-@PP U p@,X T0T 0V/U8 404 0V/p@r r @-M@P0.S00Ѝ<@-M@mp  B0?R0S Ѝ(0$ $0 [0CЍ(s 0S.G .S > -.\6 AAQ00C S;R .R0P S.S AAQ0B Q)S .S 0SQ0B ^-R 0S 0.0 R0/0*S0.S S /0S  .SP\S  0S/!C "]P//]R0S! C//0 0 / H0 0 / 4p/0/ 40/0/0O-PMPx @% !E  0L \m 0S Xh@.  ^a @^f X\@\AP0SI <  cSB!  S   XH#S`Pp@@ P pG W`W0P@W ` FR@y P0S R*S@BT00S4"020 0 ,S 1.34:((00@ЍAR R !!  X@\ P\dp `!S" Cr ;"(  X 0@Q 0;S@S \S ! C]R X @D#!2br   D"2c" Ds0#10DX0@GRP T R Sp pg 't0`Q0gpg '0!"@`D0Z갞00Dp X`n |]xO-@p$MxWP `d `XY @ppW P\W, .W 0E0CI XG0 R S.R@ pW0 C B5 X3R XPń, PEU)0S0P'pW [W# P @d0Q P @ 0Qp' P @pW6(00$Ѝ] PX p GYN0xSK2  000 B @0XW  /RX ]R=Q P00   0 ]R' @R " XWSQ   Y I b"r RyA  RC .R p@WLd@՝@ҝ00Q   Y   " ^  @WX  P0R P@WX(@[p58:dX00P Å0\S X ńW PEUT0SPS0WX l h 0G-PLAQ@J*p`0S$ RA @R0 0. 0U8 0  ؠ 000 P00 p pS00@N0?V0Sx t0t 0.3AS 0S!0ɑ 00U'@(00\  f O-`V MP3P#VP30 U0p\ @ W @RH R R4 (00 ЍW@ Ġ[? A @ GRP@R\ 40S4  0@0[A[V[ 0 0.ǚ Y*@T*0P0 A\ R!"ɑ 40S4 00d (- M~ ЍO-pS$MP Y p 0 pS 0S0@^q @^` \kS0YH `  B@  p p@T @0S @SW pZ P[T @`T00 S Sh*p 0A>S] B PY^p0K X Q= 4(00H0S 0Q* 0F S0S 0 `  0AS"`!0@T`00\(00@$ЍAT0S@"@A@pZ\ @0Ġ?  0^q0A>Sp0pS000^ 0AA^ AN[ ^( SQ0SP? Zp ?0.40@B0?Q0S J0 0S/ࣙYp 00ꙛ00@G0?Q0S j|0| 0S/x V*p+Y P HP 8 404 Q/0mci p>cP0? 0 ?00DPp>cW00XS UPpb 0K00XS UpbPPp>c 0<U0@PP-@ p>cP$IW `0M0 00Ѝ( A-`(!$1PP rMp0010+ V3 @^X0pA00tA0O0 ??O 0TA0V PP'0 @ p00 1 30rߍT0FP P0 V80G4 40 > H IU ĈdfU 00- $  M  Ѝ  -- M0 0 ЍЍ/-8 8- M0 0   Ѝ Ѝ/0 O-@SM ^ YXd 0pS000!R !3  PP E``#Q9\*Q30A 0#1#2#4#8  P:   0U A 00 pQMQP 0@pQ 0S  ЍT000@0080@4 40 0000pGR $A-@`Ppㅋ0 yPᆋ$0M 000Ѝ\ P*0 0p@-00Sh@@@pXPXXP@PD@P qP D p**|X p@-P@ᕗ p@A-Pp`ip@p0@l@  U  *6<0 i  A (Qo]ZA-P p@` F  }000 @P p@-@P^Ppp@5O-MBލpሖP @P  4/P Q Q 0 0@0 00P j0 0 e @X P 0S 3/ H000P R< %( d  0@-@P$MP U"  0P' 0 0   0rP $Ѝ0`0~\ \0 UD0@ @0 B$X~J ~SJ d~G-@PR  RK \10Xe0S@ DqP@@p  #)T0PS.0aK0000S C000  9000 1000 )t%000G P00H D0D 0 s L ~ ~X~}}}8}s(I ||A-`P8  0S@P$ 0P @S0pKP0S PU @P k @0Ue 00 {\@ 0@ P 0 ,0, 0 ! G `{d{O-lMR0  04 吀0 R X $`000Sa# 0S00 #34  04 0fP Yژs@┳P3p 00V^ p p @QS  QN P0 Sh @p $ 3/0  0P@Yr@RP900SS" 00C0T@lЍB@@@0|20\ 0 00SN  RH2( D0 (@ ,0 @p T0TP 0S 0 @@00D0000P 0 S PW @@_(0pS, @ , 0U R7 1S@X$1( 0 (@ ,0?6 &0 0( )0S X b0 0( @lЍ a0 0( @X( ( ,0 p } @\| | \(| T{ z D ,xwC xPwC ww4ŸC-`,2 M08@00051E@PrgQndea?#cb m!"b[n!3: bQmn! 13c.c0 mA #c[ 3nA3: c2nASm1@  00C@aa0C0C Cr  \< @P0(DHd,T$@VR gR 0` `\0@ Sx 0WS0 `0R CL W`H aO 0@ `90 IISQ0C 0 B@20<00P/A!b  W0 `0R C W 0II Q B@ 0/C!b; 00PW0 `0R C ST0 @`0Q @0;00PfW0 `0R C S0 @`~0Q @0:00P@W0 `0R C Wa0* *BQ@#/ b 2b:0R0P   W0 `0R C SA0Q @0900PW~0 `0R Cw W)l0 @O`j0 l@`a$9Q 0@0P  WR0 `0R CK S* *BQ0P /@ b bR  ( 0 W10 `0R C* S Q0P @ $( 0 W0 `0R C S'Q(0P 0 @ W0 `0R C SU PU P Q0P @ @' 0 gW0 `0R C W 0Q @0600POW0 `0R C Wp0X*c @Pc 0+; x08p& W0 `0R C SP 0@V0@ S0ŘW0 `0R C S9W@0 `0R Cx S*0051E@!2 Cd0bSӢ Rcӣ? ?"?CP0 5 0WP0 `0R CI S 0@X   pXX0 S0R05`10P @0l40W%0 `0R C S40 @`0P S@0030W0 `0R C SW@0 `0R C S|0 @` 0@SX @ Zqp qp 0@SJ" R-Q R0c((HQW3< #P@P Q\1 0\QTP@n 0@N@  ^0#@;\00L 0 @c\0#3S0@ 0) ( 404 0@-M(@0@0vЍ( P0 0A-00S`P`0S@P ,0E UPp@ P  pL0l|] 190@-mL0l6\|@N<@h0P Q 0-S 0#-L ! b4 0-S0P0S00S0S00] DO-PS LFkIC.Pl_e`@`,喅8\?H0>;N0Q8 5@0\?5O0(<2@ 0>;N$00ESSSKP@"0 cbG$d/'b2c /B/`0`01>a` 51E0"&.b`` :," 4 X   c 0R(: 6(QS X00[$0/!+>0 _Â!P2c0Xÿ0+" ?00 #2>PV[ c 0&(: 6S X00[$0/!+>0 (a o!2c0Xÿ0+" ?00 #2>[?PEG'` @Gpm1%0P:#0  ό"!/ U n13:$  p C0!".#2R> ' @0 2 30 #1d0TX04? B4sppp00/S [js0c (Q  _Ṅ(: 6S X00[$0 +>P!2cX0;#0(PV[Pp`vc 0&  ᓄ&: 6S V00Z$0 *>Â!2c`V0:#i0&bnu8?O0P PcR` PU0$I"IVY Ba!kC(1 ? c 00Y0(: 6S X00Y$0! )>0%!EÂ!2c0)XLß8\?H)" ?00 #2>r?D$0CI"I 00/A!b,!b S`0 B@ 3 1I!` 50.c((H`" <2c0 4S/  0` p0a8\?H)LN*" Q @ \ uO (@ό"! W/ }:&*V &R Z$/!* %!E!`& V 0#0 0 C2 Ό 02!>`V0`000 `000T@DPP0S`@( 0 @ 0$ <Ѝ& vc )1 ?00㗃0):6S Y00X$0%(>!E!2c(\/H)L0Y("1 #2>D<0@004P<`pc' 0 P<0@004PT 0 O-@P`Mp 0S,  U 0'[? PI`O  # ≑0 ]P 0U000 S?S00SX 00PN<h0(0s ?S00Y`P E0@- MH@P@00P UNLh@(@ Ѝ0 @@l@pE O-M000 S0 $ D / `P@L(H Ha<0/aQ(s#x "xH q~~N`AN0S/"w ?'P P00 #1?B! 0/@Z0S< @# J"p J㩀A0S'"̃ ?,P P0 0 1>!0 , Z0S , * *B%/ b Rl\ Q S k'.+N Q( %@ \/%O (,"@ .+N4 ' @8 *)|\H rL$   mR @@@P%"PP"gף  pC @)n$A[ O@:4@` & Ό"" \8. $ 3 #!d_  0Q S@o!S \ )|rLR(\/H .+N Q( %@ \/%O (,"@$ .+N8 ' @< $) 4   PHPmA H b"`%@g׳ pC@  P* nA%Q R$ _P:8 @`  & Ό"" \<. 4 3 #!d@Ϡ0So! @ S @ 0 !Rc0@D S !*Q &@RQ ^ !.. ERP b) L PQ\H/b"`  ,Ϡ n kN,όB! Pp Ppᇒढ़ p  Qs  ` p}C&R ^, ΌU W P@v `3`#p\ 0 @D S  P \(/O 000c^S(;Q00@`0@P`Pq%WUv XV V0eQ%`? 00?0S PPTpV P0TP`T 0 4/PT t0Yp QAl Q=h, Q9d@ Q5`( Q1D0@S QD! @Q!SH Rh0Se `V 0SJ1F|Heph@ 0 S LpG|Æ00Ѝ%WUwu\ PPPpTpP T0RwSR SR VpPp 0vXV@ `VP`Tg0 P 0VT0Pp 0]ER(0=;0Q0;0(060S (P0T 0P0 T cQL0  00( R:% %/0PSCJ#=␠ 0$A0 S2 00 0-S2 P0T 00/0S/0 0  Q0 p4"<Q$1\+ LqpX Rppp`Z!0,p`$ (0~40\`^{ P 0Q Q0$0Q4 Q$!?08:S S^ 0K08*S RX RX 8C  PK L @x|W# 0 PNE+C;E?p.h @0Xa`10@@X H~P0Xp@PZ a0`104~P}  p ~P0/SH0/SEP0/Sg <`F,h  QP Q Q@Q@QDQQPR hnB 僯Ahn (0$ Ձ$ (0`  Q$j(P Ph`4p@,00(0S. \0  4"< Q$1X@W QY$p P0` @0\ \0$0\4 \$!? IY (P,004$ Q SF n 1 R[F,o 0!0S  0J0B0 0:0@# 0S:=01 R 0S]0Q PS@2dl0 1SsPZ0@ p W0 S.0h! /O0 BS s P S 0S >Sp@@0GSЍS*S0S -S0 C R0p@0GSht0P0 Z 0hS0 "1Ӄ0 0R [Kh0 000001[ <[%0`S0S >S@`$ 9h @N blh&hp t *[[ -[00K S0@JQ@Q,Q ;Q^hNl ` ;Q,Q_ QphY$-  P m6Shn0`K19mo\ϬPhn R)luktahplw  N  @h@ @  @` P 1 00S1  0Cp00P ,R000P Rhilua0(l,岷t)l&参Lw& hp (,"@ {,.O4 ' @< . /O@ 4 OT`` $@8 @ p *8*Yv0`[Q- K  bQ45:<bQ8 # 3!d@ /p pcW $@ p ),"L@  @4@8΍P D(l @$@@b@P( , 04 #8#@ cRX 5:` cR\ 0#031d d0Z l TP  QH`Z 0 Z>YDHpLP@ T0gf. bDHpLP@ H!Q!ð!W p$@ A-pQ@V 0St!1h T U Dh6l6 `P`P 0:S  LP pW`Gh^X biP0T`WNL_ g@pS W 0:S*S+0Cs013ZS@Sa0CS`P d@- 4@4@P @T\"0 00P/v p,0, 000S  /v pP$ P/ $$ P/@-@@ @@$ @-\F<l0hN 0Q S \PK~ 0 \ F<h0 0Q\p/@-5~ 0 O-MP@TR " " 8 RH[sa pX  @PV" Q 2P0l0U;B 4 ]PP@ uS=D0C0C P S\@0d@D/  @DAPt!!10F?o 2@V0c0c80Ѝ1 00@00o! pP ThP`8 RxP [ U La` `97P ЍU}  pYP /Q/Q Q:Q  h p`000;4B @|00ht mTW^ X00hX yh#  # ,`h! 8! 4A- @p`00S* PPV0080S 0 DU@ o 0@ (}@PPq p (  /|0| 00Q p@-dPP P@P  0Tpp@|@p 0p p |0| 00P p@-dPP Pp@P  0Tpp@c|@p 0Tp p p@-PjP  @`PPp|P`p@-@|P|Pp0 0 0A-P00S@@@ ADt`tt`0Sk@P,Pp@ WP @o p p@-`L0MH@PD0@DW0` PN<h0(0Ѝp4 8p@-PMH@H0H@0`D;0` PN<h0(0ЍpD @-Pl0 Mh@`d0@Dp p0 P UNLh@(@ Ѝ@@l@\ `@-` MPCd@d0d@0pDp0 P UNLh@(@ Ѝ@@l@D 1!0p@-P00S2 x@P/0 00`V  0)`PT p ZppD` `0 `P@{`P@tl p0 d   lp@-@PP L 0p@44D$ $0 p@ Hp@-@QP0 0P L 0p@44De$ $0 p@8h t0P0 0np@-@P<P80 0DI 0 p@ T0 @- *c4M$@Dc`0*M$ 0 `)` 0\  0Sp` 4Ѝ D0@-Jh@P\ 0H 2P̌ 2P0<1w  p   4  A-PP`@! pp5T P ` @L2L€0'00#S €^"R804 40 w 0YY 8 Xp@-@R`P  p@ 0 0 v t p@-@RP`  p@ 0 0 vhD  O- MBpP@ ?0 P20P2LBTH `SW !Q L 3/L2S"P2S`% @T2 W0 R S `@T& 0RS> ! L3/L2S @00P2S T? #3T #QP0P0@T@@P20CP2nP2SU PU Ѝ\00P2S `@T 0400P2SWWxWhW,WVtV VUU A-h!`d1M @P00100P0Q0S0 V8 T?p `0xq80|q8OQ8T@D1@V  @@TAPϠPOPC0@ 0 0 1 30ލl0Ph h0 uVP0QL L0 uwT 0 I`] \ 0- 0 M Ѝ[  -<0< -0M$0 0 0zЍЍ/[ 0--M0 lЍЍ/0 0p@-P@XGk`00C`0Sp S u P X0` X PX>kpX\`u[ \0 X0`00C`0SppSr P X0X /X=tZ -404-0 M  X ЍЍ/Z -4 4- M00 X Ѝ Ѝ/Y G-@SpP^ 0S:X( (S Y" WH j0` V V,* vp0J00S0PQ`wT000@00 `pp`A0P/0`VpC0 00 j u0 0SJ 0 00j0Q 0 t0= 0 tIJqPX0T T0 t0 0Crj I7q(t`L--M  XЍ Ѝ/ -- M0 0g ЍЍ/@-PP$a$M@`< .pP* l@P' !0P/S0p@0 0 0 0 00   $Ѝgv0000@$Ѝ 0k$Ѝ00>, ,0 KtV 0@-@P i 0SCi0; 0 -t|$pR[@-p@-@QPJ 00!R ! 00! \ uP 0A` / Q R'  R0  B  P R 0 U00SpgP#ngP `hgP0\0WX X0 s00A80<4 40 su 00lD RC-` $P(@ R0 ,°00` 0  a0R00SL PAD\`6 pgfF0V `1!p  w0S<0V `1!pr  w0S  p w0SB0V `1!pT w0S,0V `1!pEOMw0S0V `1!p4 >   w0S pT 0V `1!p@@@"   00B S0 ## 0B \00C$R w0S p% V0`1 !p0 *R# 0B@ Q 00B S i  w0S  up q  w0S dp  ;  w0SV0V `1!pw0S Gp 0V `1!pwX0S0V `1!pw0S0V `1!p~wM0S0V `1!pqw0S  pw/0S0V `1!pXw0S0V `1!pK pu pn pgs R  0 0pZ  V@ `1, pJ pC  w0S p6 0V `1!p  w0S0V `1!p I w0S p J w0S0V `1!p rpD kppT  _p$ Xp QpI Jp)_ w0S0V `1!p] w0S0V `1!p , wt0S p 0V `1!poE w0S  p$R_0@' p7 w10S py 0V `1!p@w0Sj0V `1!p3w0S pXw[0S pL@ w>0S p? 0V `1!p  w 0S p* 0V `1!p pP  pC p xpD qpP  0B Q^@   0B \0@$R8 w" R 0O0p V@P P P P P P P P p0 S p  0V@`1!rP $R@00P yP tP o}Pz jxPu esPp `nPk [iPf VdPa Q_P\ LZPW GUPR BPPM =KPH 8FPC 3AP> .<P9 )7P4 $2P/ -,zP( &P# !w0S p 0V `1!pP P P P P O-M M@PL %T05 X0070 L0S 0X00!R !000l00 S 0SP   RV 0L ,0<00800tCM?@h00(0004P0p d $ PU$ p%U PU `GV$0J 0Q```v00$U `0P 051,0 4 0FZS00 PaP   R00s L0S Pf?Rp1R)pOep.LQR_T n;H1 0@EL X\,lD̍ @@PH`P$`aP`$`0@ 0@00500F@ p`4$00F S$VI ,@[3 V zV` 8@D `0DCP(00{0$0<0S <0唠0@0S$00$00ZZ !1 0 7 30\$܍ ЍVX !^1 0m=VW af`P P`\@H5$0\, Q00D0S0@0AZNP\ \M0004gPEU 00p`Q ,pAWSD0$0P00(0U00Sv 80Cr_qh? h; دP( H L aV <X0P H 51 00 S0 00 @S1 T0 00 T00 pP 0BP00?W0T r 5!S <0S &0P<0 00S-000s@0 `dV P0V`0   \0@0H0S P0 0H0@ 810R0bB+ S- C S9!/ BL CcS`1d00`FBQ000@*N B0k   BP \005\ Qh0004T],AZYZ5 ڸxP8@PJZ R  ^ D[ DBPJZ(xP 0\p 00|PEUUuڰ8@PEU R ^ D[ DBPPEU( 0\d0P0  HQQr<P`@PFUPU ڤ00QpP@UIY4d@Zp  l0f_Q0P `FV`V ڤ00Qp`f pVpGWW8^`P8@(PpGWB 0R`0 S D [0DCP08@DZ0DCPu QP@f_lP PP0 0pL0 S 8@D Z0D CP(0 P@`LVp^00N'S0 8@D Z0D CP0< (0,pAWWlP8@`(pGW 0R`P0 S DZ0DCP{pGW0Pt+0 p0 SD0$0Z8G 8P @JZ R ^ EEZ EBP@JZ(G 0\ 00Q5QtS(50 d0W P0`0V S(0 P(P0p0C0<0Q0  0l0QGPU P <`P0p0SpN?00(-S0 8@D Y0D CP(0 P0\H00 @* R Rf_d  dp0! , 00g 0d`0`F- 0bS0d`pNd`00`F`Fp00BS0 8H mY0H CPg0S 000Q$8Hx UYHA0PP( 5 x :<00NSg `Vsvp 0`P0`P\P@PS 8Hx 2YHA0P-(  x *H0S@0S` 0`SPPV&(FP8p@(@`FV 0R@0 S GX0GCP`FV0 ^0`0 & @  R 00P 0P0S5a= 0  ST00 T0Ϡ 0Sq-00 0S@ P8\` = P\` 8 P PH@`[pUQ  UPEJK00Q R@@@T@T ڤ0p@Q0P T`A`VV<0@p P`FV Q@\ EVX EBPQ`FV(   0PpH^0`0b S0 I2X0ICP-( 0S-0( YXRP8@PPIY8 R ^ DX DBP(IW IB0P( u!1 0ex!3t1t 0e\qpSg0( . \,0p06R# 00P$ ST00  !00T 

3 0I` BP 0?W06 p l @ ST000 T0$00 L00p 0ST0 , T0qT0 RpT0T0 RϠT0 P8T8@D@ %RDA0P ( P @ @T0 RpT0 PT0 RϠT0y 0ST0T0T0PϠT0a<4T0PpT0/ 0@00`00F SX@ 4$00A S$Q0-S9 1 0`W0`0\00S `0@Ma 0 $ 0 h ST000 T0$00 L00ypOS0T010  00 T0" L00bp9 0ST0  T0 0@@놑x0H \h4d@-` MHP@pT<0P 000}PT Ѝ A-@P`pT0 hPTO--0p@j/ (30P    O (jY:0S 0P0  P, , 0`00  DЍO0T! H+ !$" L   +R lW  a R  PJ[,@  {{* Q BV+1 A p a "J< RT20[00Ө?U [ aዴ 10@0jh 0Z @a_ @000 000R @DЍ R[i 4\+ D,  ` {{* Q B{4#2 AS!;R pR : K0  qK; Pg `a{+: p 000J+t+Z0Z J R& 0z9S 0,@s00H [ $ d"" h H   `H   " 0P000SU= 0S[0S; p1`P p 0PP0S0Sw WY Y G`P P Z 0z9S 00M4(-PyZ$0S00y$0P]pPd 0W0 0 0S(N(p 0S  RO 00Y Z| p[P (@0,@0 `P7 [ y P/  @P) 000- $0P$P 0SW' 0S  R 00kYpZ' 0, PS0(@0 0 s0R 0G04[ gP  10@00S P 0 (0W  $  !v `@ ;bW +: X000 `{ p@ :0  +s+0PEAJq2< T / R0\0S  Q0CPE000V^0S  Q0CHPE000N< ` 90 9@0Z0S ,@  0P0^"PPY    ![0P0L p00`Z 000S*Y` 9U PP00M0S 0[ ST DQ0bP00$@ 0Pc @D`P 0S_4[4ZpG0W40  +"(! { :N!8N@0CB:N:00s00 R 0 R Y Y 8ዴa* ,@ 10@00S S0 0,0@10 {{* Q BE@,(@n7@P 0S0S R0!**R 0P000$0< RT2@,(@Z 0G0SQ0 R l Yj Y Sf -`Pz k P9U $01P00P400S YK Y 0pP[ (@,@@,(@ZM Q QD S0pPG[000S0SZ00 S000 p @0S J@(@0S0S< 0000S0S 0Q0Q Q p 0S0$0-Q R00$0&0!**R 0P000$010@0 p0 0i0@S(@P0S0SO 7H00S Y Y Q  00P0 4[4/0G0,40S  0 0900  pp@ (@9U Z$01PP00K0 0 00~0 00400A-`@PZUTp 0S*P@ Zp@@~Zp$S wZT@psZ@+S#S/\ /S/P@-@00@ RP@Rp@-P`0@0@R*0Pp@ R 0 R Vp@0 @!0O- MPSWPE@!a0p  T V`":0  ơ R  RW0  * 0 S 00CX:XPE* R P  P  00S 0S W0*!1R 0CX:XPE* R P` ЍP0.- UM,@00L10X   MX 0 ]P  A YvY~ ^7@-@-@-p@-`P@ TP 0FP R @P  xX00pP P(0?$ $0 aWPL^p@-@P R`PP  TXp0: 0 CW4L0^L-M ЍpFF|~pq1hpqpq1`p- Mm ЍP/> 3D-@"M @Ϡ#90c 0qЍ0@-@PMP  0  Pp`Ѝ0(0;$ $0 V  T\ p@-0@Q r P p0 S!P00pZ PP    !W @0O-M`pD@0DQ00P-5X# @0S Sl @   b 0P1  P  0 T@@  0  WS`` ЍW Qy @0Q AX00@P00  @ 0`00QA@`VRTQap0 0 `bx V 0 XT@P@0Q>W 000! @TQ 0P@020U  000 X"000@000 @> 0Sd0T 02atPP @ 0"0! #000 @lb`@Pr 0Q/ R  B /A-`0@bSP'`B0@AS* R@D@D p  paVV W@0@0  `f2& @0@AS:| ( PPO-` -p̟ M0  Q,0 l0x00Pt0-Q 000Q0 0u 00A S040w @ (0Ht@00A S TT"0 B 0S`Ѝ 0S0 EQn 0l0S $@(,S^ ?o280$0Q0$0吊Tg `` T`ڐ*L; g01S5YTӨ(0S (0SF( %0dS:l  80(00dA1! 0 ` `` `@P|000XS) PtP0Q Q0 0|x Qt000Sl00l0R  x lЍ 0@$t`0t00+S -S(2 0C ^0Stpt00S 1C\,e0Q? $ R3iSm vISj NS,@t@n P% t 0000(S0l0f 0x 00Q Q \ $ EQ0 0x0x t`l0(0|`D`V0`S9 X(V 1  @0p Px |0p0|0 `LV |0 p0|0  A< RG Q0 `CV `x Vp`v0p000400 S|  <00S'00<00 00 $˷00 (0 ,STp?@080Jp,0S$0L0HH@ 0P0b    !Tx0 `PW x0   !Tp@| D0P0G X$ 0 @,0@0@PPC0D,@Q @D0C@P@T00S0S@DPEH,0SDQ"(0SUX: 0P0  @P 0S0S P Ph L0PX 800 S p#] Z<00 S0l0 $Px U=0 PEU8Q [ Zm0P0L 0p$ 0#[00S|0D0cI hd PP dQXxz  ! x5 Px 0S ; 9 WD0Zp |00 0C?o20S Kx i`+Z 0S     %&2Sd#`HoC 0CS*R*/B B*  * ʐ:* 0R*/B B`H   0 0Tt0t0Slt00S n1CQ 0ESA 0l t`,*H } `f ` 2V01 @p &2S`!HC 0CS*R*/B B*  * ʐ:* 0R*/B B`H J ;  0 C `P Q000t0QF P%000(00t000@,@t00C QwQt0t00C QQ 0 \   $T@TP$P@OT Ӝ" V瞯< Wlv0Ct00C [Q ,t>.00C Q0N,L\,A(Q,a,|nS x Px p00p0s 008 ,  J1 l000! ` `VP $**%Qj&oF*8!`FH 0@@,Pu  PZ  0pP0Il LPxC  B\  0S5 p $0 p 0R0 0| 0P0- s P)  `A 0P0@ 0P0x3 Px <0| 0C<0 B|  x 0 0piZ   Z80{S相I8 80S0P00P0P0吪00cP0相pa PP B\R<00 Sp  Bp 0+ q &$Tpl0P0l0 0S |0 0:86H42 |0R! 00S S  SD x$ 0x000 0l  "!@Q*Q00  0c230 0x S9 40S#0Sl0000l0, @0l0S"00% PBx Pxe |0p0C|0G;60 0x0  0l0R "000000S0 EQ R7 !0l0 0P0I\0(0F0080LXIX Ro0t 000x0zPl 0x St` 0`0$@0c(80,}Axoi@x<0| 0<0 |  W $TppPIU7 x^ Px |00C|0-Z{80S相I8 80S 0P0  0l0,S$@ A0@(.00c80/0 0;80H 0l000P[ j$PU PE \P$Tpx <0p0C|0 xPxt@P t00Ct0 Pt00t00000x l0: !\ \  XXQʻtP0C@0 㑸( 0ES00@$00x0000 00P0^, 0H pP0m0HpP0gQ @Qt 0 $ @S pE:|( S301 0;: &|  0 `0#5S00 8(! l  刋 H P 0@$#$0Ae$Tp7 08P0 0P0  05 `Z$Tpv 0S p x0  ~\ 0    B!0p| l0Z$Tpl[!0l0 00 P<0SPU@P  P P00000P0l0S$Tp!00l00S90S5 Ak  000x l:**%Qj&oF*@&`FH h$0Tpx 00000|0P0l0[!07 l0 00# Y00Sgx 00 Z[ 0l00" Rx   l Px=  pP1PePUPp00p0!0l0s$Tp<00 lS |0x 0Cp|0x0! l  R_0S40040Y 9|0 x 0Cp|00l0Px]B@@-00T<G-` 0Q`"@PH PpPa0s #8z *8 "80 V# F0V B E 3  ^ pG0s#8)80ᴐ^#Y 0U 1 PP `P    !IO,@P@3ßO-0M@p 00S 21`C`0 000S  0S  S0SB00XS 0Q P@  Q RWU\Q\WI:Q0 X  \50QR i T0#03\0SWe* G0V*0F@S F3 BS   3wN0WQ 06S OW*@DPD@ Q0A Q0Q l l> U00XS Q0X j00Q )Q 0Ѝ<^0 n 2>000 )ARoᩒY 0v Q>0?0l 1 c0R:jt O-MpD0 pJ:@`00S 000S 0P 0S EA R[* @E  \  P 0PS9 Y@@@Ѝ@0 R[Y Q 0APS10Z ^@0D0CSڣ0S{P [ tHT p 0 pTD [@J S0T0 @  Tp BB! B9P DR0 SO@T]@DTDZ ` `Q ߰ AP[@100+S -SU  PV PT0 0@B\ @~s#,000 0L@BT @R0lYE^bP 0S 0 S S@0S 000 b@0 0QN"00Fe0 PV 0SP00S PE 9000PY@ ^@ %@B+`P D` 212 Qa`[000 0S@0T@DUQVD`` 2  PE1: ? @0T0- T@ T@00'@0PS YPEP RH 0 R Q 00PS00; 0@0@EKP 0 C0 Rb@Rp@DU 0S S SUU~ EPyMP@"00Ѝ^0E0 00`Sp Sj S6 `Pb@0@00 00V@ !5L`T0 Pe 0S500@ 0faF PeP\ 0  SSF\M@"00ЍP20PS0 @_@0 Ѝ@0S@V 0S S S@@0S000L#@0S@0S a@00c@0@0S `-T0J  RP!@H0@0A0 R@S 0 R S@߰ P[ B@10Q@0S80@0H R( Y0`'^ E  000@05@0S 0  BR "@q5P `@0S Y ^ 0`q0PS @ "P1 5@ `  P /A-@9>8C RP`.pn3 ^P W0@00 pU 0`PEPV 0 BP @` pTp  0 BP0U`@-`-p M @KU~0  B00C2S*Z* QKEB A Ѝ@-@0AC^ 0S R@-@A0B@SA *@QAAT D B @ J0"S1 1  !2R / 3RS/00 |0 c R\0a X0 c R80A 40 c R/[tZHZA-R\0000 A1 !0T pa2!"`'  T2!L0R L,! T TL L\LR 0@-@MS: P @  0Q P@ЍA-P$aM 1`p0S3 U10AT !0S 000U @T  0S 0CЍ 0 @0D1S@000-0S 000$ pTDW p@-@P00p R pPQ`00App@xD `80 0QApp@Ԩ pDУ0  +0#10/sQ#8sQ#4  00/sQ #2#01  //1A-`P@100("@Up0p 0S1pP@P$pP    !Il`hP081#3S412ss /"r3J / R//@-@P0@0O-0 MZ  @SpP; PaU* F B  H ^!*0I X0C0 0ZP`V 0600Y0ZP`T@T 06S @ ЍG-0PpR%Q@X A@iV&10SP`P\ 1q0i000S l1 @P4 P1 p@T `P@T10SgP@$ 000S 0⸲0Ⳳ@T 0C  pP@d0⠲iV0S 80╲ (0R0i x p|D  G-P`塢0`@Tڃ0TP$ Zp  p H0  i )  S2!:R0L0C`\0030 `0pG \ `&-0P1 0^$23\ *G-`@P0@DT1  0\E*32Q G*@@P`Pp @!Pq@0 0S 0S W 0G`WL3 PP`R@H0 0S03# R B B  02NS dP 0!0P` A-`@ApDP; P 0`0V @ *\ l0D1V 56 501 P56 +CV `C5<5#11C<C- MkWP@P WW0Y`6V0 Y 0 CII50c0 Ѝ {0P c2# RY C>C0C01` Ѝ0S0/0 R /@-phaM@P`D ?P7PP5 ᚴpP/0 S Q8 p! 0: S1>P 0uPP@0 000  0 0 m ЍH00Ѝ\PP0EL L0 EG00GO00ꀝ 0TKㆵp@-@P ;00C0S0 P;pP0= 0 EJ@-@P 00C0S0 @ I0 0 E88Jp@-@PPD 0rS= wS+ aS3`0S  +S" e0Cs\S0 0S``p0S0S0S`0`S[G 0 p` 0> 0 GEP IxIp@-@P: 0S@ :P00 P! !) 0S 3/PP೼000P @ P H00 00B00 !!: 0?OB 0p1R8P008, ,0 DFP 00XH@-@P 00!R !+P 0C 0; 0 D,G@-@P 0 0 S @80; 0 D|`Gp@-@PQPU 100SD 0  [Y ;000S% 0'$0 3/0:s00P:p00P @ P 00< R 8000S80 0PJ<7P00s0l Jh0h 0 YD 0@0 00 pRF 000@00| pp,E-Ѝ/A Q@-@S S S 6@@0 @ 6@@0 @e"F 0  6@@0 @0 0 0; B0/0P@- 0At @F41S C-P !EM `E2/A/ @`DPP4!dhĀlH`d`h0&lL`nVfT!dRAbPa` lF`!@VfT!dRAbPa`AF`` Ab` *cF0` J&Jc `` + ;k{k{퍮pc APMOmpX@Q 0pkPS`Q 0pkPHQ 0pkP> Q 0pkP4Q 0pkP*Q 0pkP Q 0pkP@Q 0pkP YEߍHEOppEE,Eߍ/a0DQ@-P @41S  P +P0#EA-4!@ `PP/1S 0L11P@*PPPU!RMPP !PRp `V D`_oRD`D``p@-@P PpPA-@`&P] VapPPQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ   V gDPDcDPSSO-P M1 S|$aV IG SSp A`TT X`F ( Pʀ ರ[ `(q0S 0P@ A Ѝ C$oB/\$ (xp Ჰ[ AT 0x^`S0S ?^0C pF p(VK ($! @$A AT$(0[ `(0 A^& S :0  b@PC, \$M(!r8 V(, T$$$1 0A(~[$7((~ Q 0 0A$` a@($AR匰0 A0(1P 0 qPZ $U ;; ;p :O-,M  R0 1 p3/,0 (Q0 Px @P``^$`P 0BZB @P UpWW 0 `PP @R㲀) PUJ[Jp p,Ѝ 0 pPPu3  $`Hp$`P  0 `P& @R㲀/P  P^ ^2 ^"  hP 0 'kP 0`00,Ѝ0  k0 P0ᰰ[P U pLp  gP(A DR 1V(Q`0  @@pP 0@-@ 0! \ @"B,B00,1S@-@0 @ B00,1R@-@1  0@mB,gB ,!O-P0`SiM: `wpᲹ@P [a   p JB0S 0  8p0 Ÿ4 o+p; npD*I ` @PB 5 7  G9 ; = ? үP P WU  P0Z4Q S!3Y@ Y Y@4px<P340 De+W $phP J@p K[WW'̠ K[@`ZZ*| `dhl`R\@YxY)lRQJ `VxV& PBBYhY)|^岠RZBB~ 0ASa@ P  IRl  a6/@pP OPĸ@Piߍ 0( 01P 0  pD!N`B6ḡ !Uv Q[0 P P$4Q$Ph @ℕ% Eu` 0 (0$`,K [UJH 0!iߍI@E@Q@@Z3  CkD{44B; 0j7 `D a>P 5 7 9  B; = ? @pp~YpW p@@@Pl @Pi @@P_0Q?`?`Y  O-@(P0P!0`5R5s`(P4Qؑ:P, Ag ( ,0XD D S 1"1 O)iꁡ [P ر % Jm> ׷ؑ@-@ 13/, (Q0@-@Q ,/00 2? 0 O-SMf` $ ZpW 00$>0S  ><` ,P  ,`P `0p! Q0C R  ) v(PN 10CSp'*w0 p0C 0-P&0 0Rᴀ  (`崀X 00p10CS`7*v0W 0b 0 .70 R `崀 `(V (`崀 0R (P 00<0b8 80 6 (O-pP,M`Q ~(00 VV 06J  (07`F0V` 0FS800@,Ѝ(0VQ ,0`1vY/ 01` 10`1 I0ⴐC 1?( '@P a`FV`:b㼦&  0  6a 0`F `Vv6:v` 0b ` 6밑1I0Yِ`1: 0 bo61,0@1s0S 0 @0' b'@P 10CS0:5b%0 C6 @ ⴒ@P b0 00(0 @ 0⸑0`(0r?H= 2  @Z  'V 0 p@J 0S>  00' '@P9 VS V1 VO (0{aV@ 'T@  &@P 10CS`*0Fs @崒0S 0S 0 I@T @崒(0KaVO, @b 1X' &@P 0VSa V0F G'@(0+1ḑ0CS㣠y7*z0YV; ` 0'V &@P  "' ' @I y洒=긑0 @(0崒6`FvVv @: 0 bk5 @2b " 0 a5, @崒{0Y3a V0F 1& \&@P 1ᴐV0CS㣰y:1b|!|0 :51崐ቐ  1! 0@& 7&@P\ ` ` =0Cs 0 7 0Fs2 10  崐C @1& &@P8 10CS`:t0bp p0 4\0bX X0 4\p , \   p@-@`PP 0 00(0`0Q0(0pO-p@` &P6LM 0Q0D00 K&00 2^V  600%5 0 D0 30cLЍw0 R*R* p 0 0S0800$00 P<080 0Vk 1S6  %P䑄/  0尡0! 00 B0R{?0尰ἰ:1S 0[S 'P 0 ἐᰰ0000S !%  P 0崐V` S0!1  BR,*0 P 20 2r(k iw0 Qx %`P_ 0 p %R0CS㣰*{0Y* C 0@1! 0C s0! 11 00(0  0RK 1S RQ  RYF  S% 20 2JZ㪠o*zJ [i PcM0V`尐00 2 i Sf -% p 0 0S0000,00(p4000(01 S0"1!{/010CSP *u00C S {?尐!0b 0 X3a0`y漐ᰐ00P500\0bX X0 B3D0b@ @0 93W W pD(O-(0Mp I @aP0`f0yPP P FPJ1ZpuP01a@0  Q1R@@10CS㣰N* 0Ks0S0Cs00  VrS10C1(0  0R/ Ѝ @Q! R b0(0 `p+ 0     #PS Zp 0 0 Pp1 S0C1ȁ,3b(#(0 2T> Y3 0I 1pgP(00(0U QPEUP*0EY* 0p1SPu YQEQPEUP*uP0EY Vp崑 (00(0B10CS0I*S @```0 `p崑P Q W#PP  @PAP^(00 (0#0!0!0 <#PPm 1P0CS㣠=* 0J1P(00  #0b 0 2 0p1P(00(00b 0 1u00C SpQPEUP:x0bt t0 1u`0b\ \0 1 r#kdD$Thp@-@PQQp "P 0 0M#Q "P 0 0@#ppO-,Pa V0Fi 1"@P! `Vp0ഀ0 0 ,pr 10CS0*s0S0SS PP 1b!0 h10p 0 Hx)1FV㴠0pp1  0 S001Rpp10CS㣰5*0Ks0S  Cr 0 Sq060W10C1 " R `P 1 ! 1 zP " "(0b$ $0 1, <O-pP$M@Q "00 2T T 200$Ѝ(  @f ꘷0┧0 7 00 > `P[  R Yt@ Y*P0 PcA 2@D @bT㴐:b 0 0Aᴐ@DT@* 0t@S @D0COo0B 0 kp= 0S0C@0  bP 10CS0P*s0SUP@ !pP 10CS0*s0SG 1 ;10CS0@*s0S#P !m !hTy*t@T~P^ 20 2$Ѝ05b,%,0 :0T !5b$0 +0 !T` !00 P-  0SH  @`tl S: `V !q, W@ t@ @DXK !q Ws 0G 1 P AᴀW@DT@:0b /3b#0 / c! ^! pPRPp 83b4#40 /03b#0 /8@W1 @0t@@C 1p 1 0@10@pC1(! @P Iy0  !  P 0 o@T (!T"m100}`   Po ,` 0R X  qV@D q0V# @0G 1K PO W R  B1T@Dr 0ⴠC 1 %!@D0Itsp0ⴠ1 加  10p " P& 10CS㣐:0b 0 /   P lHx88H(X,@-@PM 0  0P Ѝ05 0 .<O-p"P2JM @P M`0040h VW00?$G?7O0S 0SNIPIT/ l P 000P"H2 0 4 30Jލ Ѝ$ >X00 0UXS 0 I0;w0. T:+[) PK0/S  000P0: S \0000S0I SR0?00(1X$!$0 D.QPPV$ 4- 㙜p"700SY 0C \0 RK Y P000W ϝp wΝP 0@olr? > (,R Q0P:Q0Q:.@-`@-@@ $ @ p@-@rPo#X*Pi$  p@脝Ԙx d @- M@0 @ بP 0S  Ѝ`ഘ O-@lMeppF P 0` (t$ F 0<@ DnH C2 bG   p (,048`$ PpT@ p@LPP , .PnlȠ P% `p'eX "gx0#@$b* c: dJ ,n P%l̠ e\p'` ```g|@$ L " ,0# ,lȠ.% P< P PPa`PPP p'PP Pgx`@$P0#.Pc:dJ " p'nZb*! ,g| `0a< l̠` 0```0P% "0#,@$ <PL vLP@P, X pPp0 p0004 d 8<`T@@``$` (`\D` +;H`P p0 $(, `048< DlЍ expand 32-byte k@- Rp 0\M PP@0`0T00 E"P  00   -@  X P0 0 T0 30 \Ѝ0 7,0, 0n,(7 6 h1O-`0X!0M@ p 8`Pv   000 0 _p. R+ X   h L  0 0= < 40 0 0 30Ѝy6^Ե 6 4 @-`lQMhPDf0S6 ӗ@P P+UЍ Ѝf0S! wpt#](pn0 00 p@  ማp ᗗTp@@ePU  @Ɩ P㈗jしP@  F  P T 0AP0O-PE@dMZX"0!L2 `D ?&cp0$V0\00 IY Ti:Z0F0#Z*VI @`p @ p@p@P V@P0["Zc!1 0 \0 30\dЍt!p1p $ 0V+@  T,V? @ @A S 0 p A,@ [ [ @0p 0 $ 0&+ T:Z0F0Z 0 0$ +Z0F0ZV[p0@q2 42 XPA-P-2PK[M0@@ `P000  F D  4"+; @ Q a!$a"jbHd(b@Z Z%:S : " @  0 \ P \聟plm klߪ p    PPF +D 3Z0 0 F iP  YP @@ P0f000d 0 0 0 30Ѝ0 0e @?>= T0 Xx  . 00@- 4MP00,00 @sT d 0T T H0 0 ,0 304Ѝ0$ -rD- , (! Q$1 A-HM0@P0D00 p `@V( 0V p `/V 0V  + h X0 0 D0 30 HЍ$ $ ", + 0 C-P04M`0,00&`@ pW:T p 0T &T H0 0 ,0 304Ѝ$ ꄔH+ * 0 0@-,M0 P0$00` @T ` 0T P D0 0 $0 30,Ѝ0$ rVX* ) 0 @-pQ0,MP0$00 `/ @T 0T x l0 0 $0 30,ЍP L0L 0 )$ 7|)  8) \A-@p0P A`q080P0P0 00S   L| P00 0 00 0rS$1   @p P@  0  P 0 0 0LZO-ء@pJZv*z0  P( aPz`F`0 VH*vP P Cx  P岁ᶁPa`F` VB*vPP0 0 000 0OVv`:*V 0  rPP:Vv` *V  00sPP:1 b0 0O( b0 0 E(1 b0 0:(h bd0d 00(L0H H0 '(H\Ħ$4p(D8O-1,MP0C0SP0ᰐ*1 0CS 0 0*0S& 4 P0$0040000@p`0Y P P0ES00 01 PPPYg00CV 0 @P`pUv`b*P 0u@S0SZ 000pVwp:@ P$@T*t@1@A(0  0R 1 S0"s0&1!V0C 01ő 0YP0 pP p0Ӂ0C00V*R p@PpP V@ Bt@Q 0Y100!00Sb*00CV^ YPU:H2D 0Z'01 P0P P Ps01 P PP iTP    r` @v`@pVt@@pTG*t0 Y!0s00s01,Ѝ   r    rpG P$wp@@TP: 0  0&F0 0  0& b0 0&l h0h  0&`@p#X넥h0tXpD0 C-Mp`$@P& PP! 0!0 0r 0000 00!! 0 04000000z@PЍЍO-$M@HpPPP 0؁00岁S000 00 001 1ᰀ0CS`I*v0X< ؁ğ`PJ  0岁0Q !  F ^P 0 0L0 00'!A'V^@P$ЍW$Ѝ000100@P4 b000 0& lO-\M`>0pᄀ@ P30$ SD0 (0 n@T X7*#1 0Cs011 " r S 0  0 0@SD@ a,00Sp  p8 00`8,000F 1PR `V 0` 00Cv`cS00 p㰑1 0CS*0pS 00"@ `V@ 00 0 00CS00 !1  S0 pp  "VQ  IY㩐*y H≐ Pⲑ T PLH3/ 00W p0 01 , p pp 0#S10C s011   00000  0@00DpS, 0S 2 0 t   a0S @ P 3@,0p0 0 S@Dp    \Ѝ3@S00 01040封HX㨀*00x4 1pC0wp0qqpఁHX㨀*0x03@S00 01040封HX؀*X 0 0 sP:400岁 H0x 岁ᴁqpGWp*W 0 0 sP:0 0_ @Y IY㩐a*y0V* C`` FH 1`0100mpN   @  Lg`V@Dp00 0 000  0 VP 0 0 0 각HX㨀p*x戀1040G각HX㨀[*x戀1040a!b1 0$ 2 03 e>S@ Z0 0t!bp1p 0$,X!bT1T 0#7U눜($d<`tД,@lO-M5p@0, 0弱 PP a`FV`>*V6 Pp@`F``tpV P @ t@@< Pp 0(00 10@@Pp 0U @Et@ 0n0@|$bx0 6# 00Ѝ 2 UQZP10CS@*t0UQ 00PЍ P @ ` a P a0 [0 t00C Qa[ 0F 1P A0V@DT0@:2b"0 " 2  P P 10CS@g*0D@  1 PPG La0 [0 H@VTo <a0[ P0F 1P b1b!0 "1PE@Du t@`@! @ 10` P 10CS@: CP1bL!L0 b"@  =1b!0 P"0@Jz0' 1 0`10`@C1 I0P1@D Ut@0@CPE 10V!0 s00B!4X h@P`P`R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ P 0@-P`8@(P  0 0 E DH@ DX@ D+0/O-p 4M(@,2P$0 ``0p  pP`@%0f#"3?0,"0  S00#0 %0  d! "d! 0 X!p p\  P`@ 0 `.@X!.b!!     !  " !)! $   c! c!,    $(`,!A+ ;K[k{(b a`+; A4Ѝ茌 0G-~q@P` @g(XS @" 0刁@`F0 0$0(`0$0Np& ?V:@F(?@@ 0@ 0T  3 0< 0$00T$0?`@pV? @?V@F?@ 0$ @@< 00T$0?@@@?`V( ! 0$ a0 00$0A-@PP% p$a;V"P90) ` B  CI0 CX0C( 0`0$0d0W E03?R0h AD! 08R(@R )@ b7!(`P80 F CH0 CX0C)8 b%!(`R @-A/ @-P 0@-Pd8@(P  0 0 E DH@ DX@ D+0/$R @-/z @-vp@-PP X0@0m@`\  0P  P px 5O-M(@`0 @H,@}0< @0@$(@4@$PP<4 ,@8@ ``@ P @08   0 ``(0,44$p@Y0&'(Ǡ)Ɍ0&97 "0(97,;40#  0, ( ,!)0 *   ! Ϡ 0 *0P) 0 . %̠ PÌ 40 !$$P #  ,0 0P0,P0( \P38 @0`~? `008 0<  PP @@  0  4 0p000 !1 !p壠#$ቯ ,)* /3(<ᩃ( *1笩ဦေ 0嬾ᇑ1>*1 96,à+͌ +%7% 9 ,0# $$ɠnj (ˠČ 0#ˠČ (  , 0  ,4  00!(p0 0,p/.!.!~rp'/!!(,#̠p' )Ì   ( " p , p ,8p 8$pp0 $ PR(,]< xp|`tdphPP l@\T @0LX+; k{(rK [p xb|+; B Ѝp@-@@DQU  0pRPQp b1PPQo P*0P0L0@H 0D0 0p@OR Q bPPDp  @0G-q@P` gPX? H@0D 0 @0D # H00H0L00L0`FPP`6VFppp @0D P;@0  S0D *H0L 0H00L0UPP`VP  @0D a0 @0D #H0L 0H00L0VFPp  P@0D ;@0  S0D *H0L 0H00L0U`‐V PR @-t/A-@P` PF-8p@CU jp@-PP X0@0k@`\  0P RP px|R @-;/vA-@P` PF(p@ U 003?0/0@-<PM00 P: 6@0;P5 zP DP5E@05P( 7P '7P 7P@0 00w P0H Op H ߍ0(00 ߍ03P 3P  @Eˠ  @0H #p H\ ߍ0     X@0 00" P      3\ 0H  30pH         0 @ 0@0 00Pg  n  k  v  s@0 00P; Kx@0 00P =D@0 00P /h  8g  5f  2e  /d  ,c  )b  4a  1HP Z  HP t@0 00bP   EDCB <,+*)(&%RGFpp|X\ @0 00P1 D@0 00Pz }  |  {  z  y  x  w   ~s  {dnΠ@kik 0H Ϡ 壖pZ hY] 0H  哖pJ D? Bi@?=;9̠7=@00S,/+1  3@0 00P @0 00sP       ?tLߊG-8M_(P` p @W@V@U@T4 0S  P4 0S3 Q!-VL W0`b U pp P\K 0 020  @υ 㷆8Ѝ0SZ Qp 0 00 sd" P0w ! r R  #m:VW$ Upm P`10   0 0UU0  P R & U Pt\ P0 0VwW0 U p8 $1 P0`   } z00 R y0 [P0SQ q0Sy Yb @aU^  PTh0P0 TP0P0  Mԟ t<  О `, | $ s\ @ p@- 0@T 03/@T/PP *00@T 03/@T\pH00@T 03/@T$Єpț ؛ X \  @-M@@P Ѝ 0   ܔp P00A, ,0  8hqhH-M 0ЍO-@R MpУ ഁP  `A80 S 0SJ: L 0 Z 0!80S7  Q@0 8 0 0 Ѝ 2 Z   00  0 0 0P 00   |P00 2   ΒP   ǒP  000 0@-RP M@PQ    s/r?  DP 1013/Ѝ00 0@-P U1!^ 0C B^ \ L0D0p@-0P`U 1!^ 0F BS @\ `fpUpG-`P @P0pS:ؑI Y `1`! p| F PU  @P5pP pPO-Mq  PpG 0 PU @P U `1`!  <[  0PU0  ЍЍA-0P @d P 0 a`F Z P @DpT  P/0@ 0A0S5*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp40``S#U!*`P840#U:080pO-@R"|M2P 00t00] 00S80S `\"T2 0 t0 30|Ѝ4P`0  cP8} 0 1\  q$`0 8 0 0Α pW`; P'8Z> * *J1 '0` !  4^ 80P  P@R8P84`0PXP: A@8壐080 0J* "@R:s0 S pmP8叐iP8pP 8 ` 0y`P p8S00OP8qKP8nG00`iꭾ( @ O-M@$ ) 0@ 9,0020D2S(0z pWt 0H"4SkSiT90Wl 000@0h00U0P . Sd e   Sh` F dPP! EX  00h00 0@0S000 R!@Q  :SQ 0S dc/ O c/K!U 0 0 X@ 0 S 0S$ R000H2S708 R000Q 4p`4∐\ 00400pT403 0 ` ᮐp< 0PW5:z zJ` 560's{6_U0PP48 W00S  0 \! YPPU P`?WY 00S 8  Q(( Q APS !SR1@T 00$0S  700@8Q 4Y ` [ TpJ 0S7 0 4 5P 0到SnT1 c/00@ SE !SR@T 00$0S ,0S !4$0(0S (0@Tp 7 0到S dc/ a R  P!SRPU e00$0S  ?00!SR@T R00$ R 00"00#3 0 2 30ߍdc/ " 4 p 8Qf!SR@T &00$0S  00@Ndc/@0p@ &uX *` h(g"0`0S(X U`3(0*PUY``2{ 08` {Hrp8puN0 S (W(` `0ࠓࠃ\^\_S44000080QS80  PQ`0@ gP!SR@TJ h00E@ @h 7`㞌(0PP ` 8@P@ @ b W @ !SR @T t00$0S  #@ 8 ` \  ԉ @ H 4 A-M`@P`@p`@~00 0,00(000mP~Ѝ̂ -0  “ ƒ+p@-P@Q 0P !  2!0 2pp@sp@-@P` VP#p0-P@  P 0S RP0/OP *0?c0 3??oPP0/0/R00 B-~x` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/(!(1@- 0MQ020# 0S0* /!PR*  R @ 1@t0Q R Q*Q  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@? ܺp /O-p?o,M2PP00# R00SHW=  0$00 R00    0SU 0SS0哨(g 0 00(S@C0 $P#  7/ P7/Pa 0S 0 00`PcPU0= E B R Q@F 呢"`B`FV `!VY*0SG* SG:P 0Cx0 0000S0  RR㢀@($ 0 P   P7/ 0P 0?  ` @U) 7/PX X0  0R0X 00  0 @# 0P0 0 XP  S0PqX 0 00Pe" Q0P0 S*S: "X  QX E ^@F 呢"`B`FV `!VD  B.7/P  7/P} 0 S 0SR0#! 0 R 0S0S㣀0哨( 0 0S@㔣$ X B`S 0  1 ` 007/ P 7/P0H 0`7/ Px7/Pڅ0 `DP7/ P^7/P 7/P^P$0@ " Q0 @  7/P @0@0St,Ѝ P2 0  BP' 0 C06-! ^@F 呢"`B`FV `!V  B&a`V|7/PJ 7/PPB7/P 7/P~7/Pl  7/P d 7/Pk  7/PT 0 0 0哢$ T P`c⃰@ @Z* @  Tz@ 7/PrU U   0 Y00 #0Q0 @0m< <0 (0l$ $0 |kk4>Tkp@-PP& 0 `V @`0@D0T0@T` ,0 3/Pʼ0@00pD0Spp@/0Z 0 !<=jp@-PP00 $@t@ $p@h 00, Pw @wp| pR0 q R/ S/p@-@PQP7 100S- 0 5   0 P @P S0 0$0 s0 00R 0   p0  0c0pSj,0<( (0  p蠵 H;h@-PP,qM`@p) V1 T9 p p {P0 :CRo  S L 0( 0R  ; 0 Ѝ;0t0p p0 VX0T T0 T<08 80 ` |:ggT:gg,:pg"2 @-@PRlM0P0d00< 0 C 00  `"T2 0 d0 30lЍ 0`0S& p0PQ !W P00^0pS pp=PP000!|1 0 L 0S$pt!@ PC T10F LD10/R  0 p 00 2   0SP ` 000p p00` ppt p0p 0 XPa 8ef$8t7/ddp@-@0MPu00TavV( v0T1S O6v0T1Sv0`v00U TX!\!R Ѝp@u\!v00Ѝp@u00U\!X \!X0 000S/ p0 0p@-0PUp@0u00TQv0`U TQUP upX1P0X1v0T0`X1 ph0h 000S/@-@0nu0 X10CX1S @euOT1u0 @^uH p0 000S/gЭ p0 0 0S/p@-@0PEuU00 \A\Q X! BX!R p@5u`Nv00OT!u00p@*uꨭ p\ \0 -4M0 0,008 00 0 ,0 304Ѝr Ԭ p@-@QP  ,Dp@y09 0 T3`O-M`P8@@ p PP1?!0 fp 00D> 2@00D A Bs QR 3p `> 00XS W pp p00XS W& p0 0> 0 00BA0C QSWpP pWW 0@ p pp0@ pp~` t)G0M0 00Ѝꤠ @-M0 @| x   !uP 8 ,0 0 0 30ЍC9` V 0@ S 4 0 /@-ȟ &0 S 0,/0@-0&0D S8 0 / 0@-0( L&0 S 0,/0@-0%0D S8 0  / 0@-0(p脞 %0 S 0, /0@-00\X%0D S8 0 / 0@-0<G %0 S 0,/0@-0D3$0D S8 0 / 0@-0P< `$0 S 0,/0@-0X $0D S8 0 / 0@-0d蘜 #0 S 0,/0@-0ll#0D S8 0 / 0@-0x #0 S 0,/0@-0"0D S8 0  / 0@-0P t"0 S 0, /0@-0$"0D S8 0 / 0@-0z謚 !0 S 0, /0@-0f!0D S8 0 @/ 0@-0Q ,!0 S 0,@/0@-0= 0D S8 0 / 0@-0(d  0 S 0,/0@-08 0D S8 0  / 0@-0 0 S 0, /0@-00@ S4 0 / 0@-0 D0 S 0,/0@-00@ S4 0 / 0@-0B耗 0 S 0,/0@-0\ @/ /H-M 0ЍA-`@pP8#@pW0PpP@-Ϡ "M R0# 0 ! P@, O !PЍ  0S RP/O0?c0 3??oP/ 0p@- M0P@000@`0@PP  AP< (0 0 0 30 Ѝp莬ȕ `U < A-Q`Pp@ S V 2"RSP P^ 0Ci ?o/o0CS 0c01Î0VS' /o?o BR W 0b01Î0pϠTX⣏0̏ ^ RV0 B V  T" 4o 0a08/ooAq!  R b0r<·V pV50o800@b>0<)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGO0 0@-@P  0000PA / RC/A 0\R#R! R/ 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGOн 0 ///Q R Q/U/Q0 R Q/00/Q@- S@ 0S@ \ 0 000S0Q0@- @P' TS0 C0 ^@DP \T0L^ Q^P 00PPQPS @R S Q0 S00  / 00/U/S 00RQ0 0/ 0U0/Q0@-" S$ @P0C S@ PP QP @\ 0@0@UP0@Q0@- @P ST Q@DP  ST PUPQ P00S@Q R U// Q#/ C/ /s R PS  00/ 00/U/ 00/SR Q 0 / 0U0/ 00/0/R - /p@-@RP` R V  U  R 0 p0 0 GQRp@-`@P 0S0 000 0R 0 0p 0  0$GXGR0  S 0Q 00S00/ 00// Q#/Q- S$ PQ PP0C S00UPPQ- S0S P 0000S0| 0 @-M0@00000$p$p00p  p4 ,0 0 0 30Ѝ蟨 -RBMM č dd  @T    PLn:2  4 E4E%0 @-@-`x@t"Mlr MP p $( rN TG <<" P0R @$@$"P `0 t!1 0 $8 30jލ ЍBn!`@ 0p [ m0 B^tP.`!0 `{L100@A@ 0 0 w0 P \ AL+\ \^  \\\\\̧1x 5 @DX5 $D؃ <4 P$LC 4 0 J0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A@-0@0MP >S@ BP 0 !#00 8P0ЍL00ꀃ@-0MP0@ >S  @ B"00!,3,0 P0Ѝ*00@-@n@n0 00/} ,0,0-M 0 000 0mЍ| -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/|| p@-@p@-0@ ,pepP `0Pp踁//////0- //1O-0,MPp`W 1P(0   B  @0 05/,Ѝ@PL 0S TTT S0 S0S1*(! 00S S& 'S000S  0S S * RpC 0QW 00/0 0 0000p0l l0 T0T0P P0 J뭄@|Tȁ: `:(: 8:/Z/[/O-M-0= 00000P0Q0S Y( ZF008= 0 0$0(=00,0< 0 0< 0e c X@#2>""d00 < 0 [04  5$ 0 00CS0C Z ˄0S*0S0  Z0S000SS 0S  0  0X000l00 0S+ P P@` 00CS0C  Ÿ0S  ~0  000 0q 00CS0C 3 `@P [00K0$#3 0 0 30Ѝ       9 0000D0@B0 Z000 00  S*p}0`00`@P0f,  0<@: s0  0@s0 0A@00 @ s0 0000 00  @pV 0 0Y 0 0  @   0pȏ0T0  0?< fDy   T1t1n \4-L-0 -A-P@@ x0`pP@PU J0S 8/`PEX@upW$0: 0 tk t(,4, 0SS S  0R @-ro/ 0R0@o/O-p !1CM M@`0Q0440eP _ 0 0 44 30*Cލ Ѝ0`@ 4 @P tp0 0@XL+ _f 0Zf/ꔡDj j i *`G-`0S+ S'QU$ pW!@0 S00#S0S 0S0S0S& P# PY@ Q@0 0R!R  "R R R QO-0BMpMwpWH1 P`0 pW' 0 'ZP@P UZZ0[Pb6PD <0 0 4 30BލЍg f O-D!@1 P AMU M0@040O/ 0Y,:0p`x0(S3 0t@?s0T T. PU Z Z 0 P @T $ 0  YPL D0 0 4 30Aލ Ѝ0x0(SꝠf e O-mMM?x /| 80060 [ !R & R0 ` 0  8 ?T@ X@0x 0|  0 P   R= R30uo@P【  pR JP p Ḑ gP R!Rs 5P P@[ 0S!  00 0[u`@PPP0S@ 0S 00 9 S 0S*ڌ-  T x- \ x X < l  Ra0d<0v?@L00H0< 0h S1S H 300S S00`01H 021帡ZY0P0|Sx0D0<00SsATp H0CPo L0PPPym 0;[D@   P ;@90P4P 1 < H0 < L 0H0 L Rd@0S  P0S(Q <00 x  R  P RT \{|`P@p*6X @00:/P +: 0 6 30UmލЍY <@PL0Py !|fL0P0 u  8 : X0X L0x<000SK0`0LH0`Sd0c  `@pPV00 `G `?:0(0 `$ 00 0D40,00 0 4000F00dPP+ U=00 0R0N `1  8 h9T0 X0@0VZ@0  u0@0C (0$0 0SM0@ , ᐐ#/E)b,"dP 80S 4@20P q8' 0\@q 4 @0@0PD   R  0 0D 0P]P`1  8 7\0 X000 0 1 01 0@0D`0  @ &dP& 0 P` `1 r 8 60 X0`O00 0 0`04PX80&H $X M1Q0 U 0pK10 O 0$0Wvo@PQ@   W 0 0000QP O x$0 vp01 000Py 8 L5@ X0O0PP@0% cP0L K@I0P p8h$h 0@∀0 3 (0l00@0p8$ 0\@q0$0Wʣ0+S .0CS P 0@@ @0PkP41" Pn `1S 0    P 0P0@0w P@ P4`!!! Q0   38 @X0 Q 0P R0 . qW `R@*`Px 0|@7/P   `V q8 H2@ X00`!8 2@XVS0 d01SH 3h0h00S S00 0`P1C oh0 dPf0 h0bP101Dp@PDwVpP 0 Dpp 00 vbDp0P00P 㸠D4 e e &%%D` !lx$<|Ll 0ddPT\H TP Br DR UbP0l0P0@@ l06SV `l#V6Spm06s P0 D0P TP Br DR "bP0l0@0P Ho8! 0d@{0S\ 0RT 0`1 j 8 10 XP0&0R  X o8H"H 0 @~8 <2 X@0l&0R  ~ PD iP0Sse=00]n8" 0~c0pv6 G0r 0R D0 P T Br DR  R,#aPʉ70 P .@ 00"cPhP 1011S1 00 8  440 X0(048 X@" X@0&0R  <0l0l008 4 X0000 0`0+S .0CSX@0P Wn8,%, 0(@~0+ (0l00l0@0Px 8n8% 0@}k0l0 00h0  `8 6@ X}n$$&$ 08 }rz xPv0@i mpp&p 08 }\/ /MM  00  C R1#0e(6,Ѝ0/M- 00S  R BC0S N 0Ѝ/M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@aP$Ѝ0 aP0/0$Ѝ000 $Ѝ00@-$MP@{aP$Ѝ0 aP0/0$Ѝ000 $Ѝ0MϠ-    Ѝ/MbA-   1 ЍLa/O-4#03CM M$S4p0@`d04401P$D 0 D2$0(0,P0000 (0 %| 0p i P;QP0$d400> PI00<  !7 S    ,d4 0;0 P 00 00; PPG P00 pS `P104430KCލ ЍS" \S 0?s0S0Q. Q( Q" ES      0/?r s0Ͽ|X{"SSSL8K D\I $ ,  PC-PH AM@M`p0 4" R3 \{0 @ `z P,8ĝ0  0 0 4 30!AލЍR7 PP 0@ .R@@T  z@ @ &{RG t ؿ)P?Xp{P뵐0 % rP  @nP U@D0 T ?R0s0?0  ЍXL H0H 0  Ѝ(@d0G-@P p`㴒Ḃ- F0S@`@0WV!< *P@&P, @`DV00W0S ?V0*v`DGP0?U0S dJX AT0T 0 8 =404  0`@\0O-䡐 MP0S5 @d @V$0QV@0\\"  p偣 ppQV@tp O-aM M(4($@080P4 P0060M0U =0H0D`cp01',  d!0q d!n/ 0`115̠B.0dPP 0πʏ < sp d1 0d1uP^ `P `HX`0H DPS_a \ S S00 PP`0S SR#3:0 0CQS0 0CQS0000(02MvP dmF pp0n!sUm%FaRG 0s/00r$GP$ o t)F, s%r&G4 / X  + 0 5P 2#S;S 00 S' 0 0S 0 0SX 0$ 0S  0, 0S0 o>R00sS2 S S0  0 i>R2 S S(0S00 S S SS@@ `0 pW<_AP@d2 X2 @ Lx34+ 04 0S? e2R20 S S<00R00S 0@0 S S00 PP0S Se `P}_0  C0 C500 1`0X(0F MPKTP RGP 00TP 00R@0@300 `S @ 0d12d1 QYX|ᦤ1|Yp 0όs`0S V`0`HPDSH` .S`0SVPp.`FVW0 P " 0"002 0 6 30$aލ Ѝ 0 l9s4GRb V V0 S4#4 L0@00 8 DpHp W Wp WW00;W0SpW 3@0` ;W  00@pW  -PP  SP 0X @Qh!P ppW;W T$ 00@pW;W  /PXh1QQ0l0p S0DpU 0 c8Rd2 S S`(0SI00 S S SS@@> `` 3V _AH P@`0D`S \ S S00 Q`0S R:0 SQ 0 SQ0p00 k_đP.P `nV!0x3!|3`(DPEDQ f`NsQ8p#P 0X Qh!h!2/R!RhP1p 8DpHLP@&`G2  {J ЍA@nP 0mP 0S@ @R mP  A0a Ѝ0   a Ѝh0d d0 PP P   @$$@t 40A-0PU" 7U"P7UP!q|@@ ``F7_P  (/_P 0!E`(1,`P$02~P#"O- F Mf@`00 S4 8 |xF pV@p(P 0,R8 L600vW40g,1@0 6 B0R  6 0,@ 1 c  0@ 0,@'p8@ P , P} pqpt80Sg0S X 8 0Sn`6S 8% 8 0S$40S S 508 RU 8 0000040S4 ğ0 4 , YA4*0210S Pq00 S^ X40, L40$0Sp 0408s1%40 ,< p,TqP8080^ 30, p Ѝ00R $0Q*# 08s|30! <,p48Q,A%4$1Ru8# $30@(!^ ^ w肟$ S:p 0," @! %p0,0P^8(20, t2 0,@ `2 0,@ L2 0,@ 82 0,@ $2 0,4 2 0  < , 0 0,0,1 0, 꼑 ,0,10,0 R 00! 0x1x0 0d10Pp ,8p ЍCp N>p 0x ^8snqpz2 Z 00K  _L" "!!x!X     ,4 0x(ܩl<,t\D,x@L1O-0$M pW H*(1$Q0AP01o@0^O, 0 ^/@5> 00S@  @ 0~0 T0 00Z @ :P80 0 0Z@ R 0X $00 $Ѝ$(0 $0 @- nmk p@-@@`V 0 CQpPa\P P `FP @  p}\P 0`0p|@-@00 R \\  $0!0D0 0@  ( $ Tx@-@PL  0S  T0S@NS\@IS$P/0d 00 0Q,0/01P/0(00$ 0/p@-@P`P P (0S  1T  0C00`p(p@-`0P+[@P  P&[P 00p.t A- @0S  P p00   ($ 8PP(p`P0p@*O- 䊟4M,0Su 0 j*`_ p  5. *`* ^ ^  @ 0 ~ς Y  ` @[ @:T8 Y :RVZ 9 0  Ii@9`P00<0 00 A4 S  !$R> p`S=0 0,0Q090( RB 800 RA ( 0S  Q (0 (0$iHl@(pP 0t80 004 R BPȟ  B QP 8 pP0 0L( ( ' X 0 7P`0 p 0 0]4Ѝ70PP P |7@p0 00  X' 00D0DS:47B0P$700GP p@004(0 @ 0 0DQ0C$010,6P0$$ @(,TD* Q=([ A([ P` p4@U@A(@T0@ @  T 0Q,P @P$E ``@P, p  aZP ` BR\pA$kPp `,  P01#S0  D0@P@( Ț py Pg 1(0@ 0SA1 @P1$  @T(00^00(40$@ ^P` p5 $0P000033000C?00ꬰ( 0 Y 0( 0P} K ,P$idC @(P0$0 1Q@50@P$ 1Q( @k!PL$00PQ0\@[ 20P$1Q,( 0pB@0 (kP R'P( 01 (0 jPP$ P( 1QYP( $Q$J~P` p$ @@l1l!0< ^ς~0S0 0@0P /000P! 5.0:[0 [00  0 PbC \PT p$P\4t `P \pH8t    p\T  @-@P00 R ^  !$0000 0@  ( $   p@-l@@`VpPPpA0U1pPEP1Sp  (0$ 0p` QA-`AP@TpQW0W@P k0 PP pBC @xA-p`@WPP T  000P   8X@-@h@0/P 00(/000/004/00/l00/ 00(/D000/0008/008/A-``PU 0AP ppT0APX<0< 0 ,(0$ NNN/@- M404 0 $0 Z Ѝ8 @-@P 0`00@05 0 ?hT@-@Q 00 2 . 0 G-PlsM@p 0p T 0S0-00 00(0 040,0C0zPP 0` 2# "Y &= " 28  0 0000qp Z Z 00@ߣMLn < 2R"00@ϣ^ 2: 28MP0 0a 2< 21 0 010010 01001001  B 00x100P 0 R00   0)T 0 2 13/p ЍTd0-00PP ` 02 2up00m@Yi@Pe0SzZ| 2: 2dPu 2 @0 28001,00 48,8HC-`@ MpPQ 000ES90 2 ] 0 R0S 2 %13/PP"?o2R03SH lP (0 $ (p 2 P7 ЍP Ѝ00P("- $X000X "R0#03(0 $X "X002S13/p T ЍR e@-`@ MpPQ @00U+0`V' 2S * 2 P13/PPF `P 0 p 2 P Ѝ  Ѝy00PO-1PMS0:00 X'*q`I`[ ~p@ p W   0$ PtZ 2< 2ЍЍUPЍO-MrX>*`00Q̱P@Dp@ W0 [KPE UP$ 0̡1PE PU0 Y 2< 2Ѝ1PE P0 0 Pt YЍЍC-1` MS.:rBW R* U"R  R00U00SR |0  PpXB Ѝ 2< 2 ЍCUP ЍG-pMZ Rb* U 0S @ R0  D` P X‡Ѝ@ 2< 2ЍЍG-`pᴑ 0F PP IPuP(?0@ @S1Z01a@:z0S0Cs0  0S001P@10CS㣐4*y0/ 0 @00CSÐy0S Cr   0Vq00R!2 B!0C2ph0d d0 P0L L0 8 b404 0кԏ p@- @VP ` yPP ~p yPp@-`P@Q m00T T 00p(0 2Sp0Q 2S:AP$AP$00C$0 2:0 2pC-`P4M@Q 300 Vv 2+ RJ 13/p* 0 00*" "0$ 0 004 p`0 9/P 9/P H0  ^ 4Ѝp$  0qp 0 pP 2: 24Ѝp`?(0 0,009/P  S0!`$P@  @00CQA$0@D3@N0qW T00@2!$!A荜pP W0 < 0\v\dO-? ptM@PWp0 0P(0b 0  P0 Z (wp0 000 00`0S5H@0@ p0 P H  yy&0 0I0 0Აᴀ @ Rڴ R  H@D 噖0I Pq  0pH 0CwpL0 봀(00@` @r PX 0,00 $408*Y0v`G Vp  `!pG Iw?0wp`0v`s00አGZp`01*0`岠00p00{PP~ Y```0S`00F2y"0 E02"v`0 :0Y0``FVm*Xv`W ```2 0 0 00000``FVL*Xv`? Vp1p!w 0S Br p0 H0@ pp͹0`0v`s0p0pIW㳐`01 *0X`p00ഐ00 00PP @00S8`00FMЍЍ0 00 0 0 0 0e 0 00k 0 0#`t0t bp0 ꘗlmTl@m($lܘlkTtHk0<$k $jjG- p`@PSG 0 QU@ TP3  X0SI0S Q 0Ӳ0R 00ô00R00As00 BY001!*r 00 000oUU800C80/㉐BY001*/XL H0H  00 0R㲐0CShO-` @0T0 @@D(0t@S(P,0X0P'  `wJPP"  @0T @@D(0t@T0 0pW T P  0PPPA-`P0 @T@ Tp Q Q\5PTG-@`P 0S 0S  0Q@PS" 0 00ᲀ\S: 0 BS P= \0 P  0 (!0S 1$!0$10 PP 0 㼐@pᲀ 04p 0 S 10 B\ἐrp ÖP $1 (!0 $1000 O-\?  M0P`p0CS0@L P ;J pIP& 0 0  eP 0{ S0 ķ Ѝ0 0S0yP 0 0P000@- M@P p10 Ѝ0O-M@p 00 p`Hp`   PPK0SRD0Z 00@@   0 pWM0r pG W@s 0J*0@p@ 0000S 0C⸰ s0ppW㲀0=*0p00ഀPP D0ZPPЍ0 P f0 0U 0 0K0 pd }`0` 0=H D0D 0 30a܍aȍlTat4,aP G-`"20M @0 0,00w?0Rpl2SL:0JSI lPPx 2Sk1! BRE:0CS㣠j*z0Y* C 0@೶ቐ @1p01 p@裶 2 0 2g8!01 0 ,0 30C0Ѝ "P0 ZP崐 Z y0 p嚨P202  p  0000`0p$ 0 p $,0b( (0 v o^ĈA-p@MP`Q 00 2   Q Y:1Q|(0" B1"0001 0 VA0 0PU: Q * 2 13/p1 \* 2<00?P#\0 : 2 E E0P VP V$P 0  !Ѝ 00Ѝ0PU Q:(0 $P0PU`PFP  yGP 21 zH]@--M" #   M<| @xP P0Sd000S 3/L ;=0 8 80 0(Q/$(0S/ l H\[<<00 R/( 0S/ |l к P[-AF hFF #x /! F2D M)h1 J#F I H F0khBF1F8FAG506|g -OFhF:I RJ9F FBћKLh$4+m ! #  ~0^ёI lB(Рb+I+GFF"FFFFF&F+FFFF05h>[I0F` XK0FbhXI*FF9hOFTH#`;h+HH(dhGM;hOF#`O "Fkh;k`+(F AF *P(43 .1ѺZO 4+B4 .&  6I-HJFvd0[2իZ !h/H#`#`d0[?EE(F0O 4J#IHNd0^ 4#$ 0 &0F . .3,4+^ 0I 02F&Z` o ~'g (g @g $ fko 4+. M Y0- T0 s20^ F0?v.F@? +hY)`xJ竉#`$8Fl#-O$FhFFFI F%FQ%D#J1FK8FC[R(4G((;Я!f" 7h(_H8 (S GwwwSwwwwO %x(e(X( d(#jKhO hI hB:V" -ђEђx ; `^Kh/,йи XI bO %FO 5%ENOMO% |V#  PFFGIRF F% F0AI"F&)F"XF4F(^IEHFmhpCOc")F\9IZ `^FhpCOTpCO*j)I1H! pCO1 س_𰀳_(Fv!O𙀳 Ol+Ё(FG#j*?+ J)jHz bhjPC'Ѻ)jH")F OCFt\&clDfic#Ѣk?HSco@"h*OckDkE@րg#k+b#kcccl*AF t]O F "lU,ԢlU,ե zh"m@C bF@F   ENEі@B*AF(Fa `Z"|(*@BF~ @APL8`}I.  @J#ccV(?kIF 5h( (F Fcm+1hpHF0pCO(FF5hak(F;h 1(4l:h  (F228cm+YH)FlYXcm+SJ1hSH XFHcm+LKZF1hLHccqЖ8+mB0EF_аh23!C#23!C#23!C# 23 !C # 2 [B 22[B22[B22[B2F`8hAF J  ckKEثz˜F@Esh(-hD#2B2+`#p( E(S("IFH s( x(цIHKhK"}K""zK""xK"!3; hvI 4! 0sI ,rHfFjIpHoH,bN)Rѱ(U]K2+gJgI^HfI TK" hxhv!Fh&( F Qhx!+"RHh+CINHdhx+ b(IH^HHGH*2L1R2I>HB@HG(FBX2+3K":I)H'KQ3,"`#, M1D< +.H.J#`l#1@F`M?XiiF(?QIH (OJ2+?uK"H!` g ~'9B܇!L!3!g Ĝۜ@g S22˹ IHAH F(2+?!K"` F@ J K I"HpJIHjg ĜL!H!ۜF hF/! FD FoIF(@mL'mJ1F(FCPkK!hh)`i-! (***BBh:W"P+iF(F (@pC O@p#`RI*F 2QJ1F(Fh0KKh*V#Qh 0z!F w(e(L(1P(2F(+дf8(S o y}    y      gao#c`lg`j#'aa`e`c#a#a_'`]a[`Y= aa ki)hdIV#Hyh"iF(F LF(vpCO?WB F")FCz!` &Hҽ-OFhF(VI P O C%FQJ9F@FC NKhW#0c>D#nm(p(O е(DM(hF *h AIL@F0FPZРF:I@F8I8F5IF@FO F 0)F (Th F ( J`!F#H#pBO:#/# 0)F F 0VO,x)F F (1h0h)F 0&` ~'%-OFMhFdXI PWM&WJAF FCTK , OI(a i , qhX*"i( f(h(еsv(#k`a"###cE  =YFV% F(pCO V%@BPFoF  )ID K`c+ }-K60+9H4H7K#L ` #1 >SKF0+'H#X#x+dx+#PM$U 4!,єI %0A"&h;";"`D";"p;"l;"b \G"ȓd;"\-CFhrI O^qNrK$`3h BX#mIHFvFHFvBiJAF(FDB2h*(,aI a+R#e/////i//$TO!8h (:h PI$$NI (KHKI (HHHI (EH,У+h3j=M#3hq+F,(@6I2}ع*hh#x320[ FFF*!FL#3I" F aH!F,OKI *(HR &` ` |~'Bt @ht@t@o gth -OFhFI O>M$FF&FFDx(`oSBSAk`K9FJ@FCєK иѤ+6TлMЊI R(%G((0H8 (S 21111111212O &h(d(f(#v(#nKh#O &O O #&FO33,FkhW)+=:!PF<KW)@#x;#+'UI FMK`"1F@FVF(@NI N.!PF(HIPF0FCI F0PF F 0.?T(FFI*F HOrZPKC $"!FFH(xg I",K"9md3I"(Jh(KZ`#N$MV{H9FRiF w+n;+f+ I 4, mZe "p18^`o"0@g 'g -OF-PF'#FFF AFJ FAіJ ,8l-ѥrQBQAIH" |?F-ъJI ~t(c(S(P(dE B n( t(#Fa(|JF&-d-!d-C R- S-/Q-qI*F :p-r-Dl-",=X*HF2F{ # X*"aIHF 0^I X*"ZIHF 0XIX*" UI HF 0RIFP X*"F   "YF~,<MQFAI"FX&WE&6BE:I HF 08I*F&5J6IF(F*X* 3IXF2IZF(F^IF0J(FF(F+JIF *I  J&IbF$I |,@𖀆 F&X*HH!F FNv:j` v2~'~DD{D|D(}D/\5(I F(F%KB.=s@3B0QF(FFNEW(O 0 IMFZFF*1F(F"PFFF(FIRFHRFFOqnyarayg -OF-FL#M222423322O3 3 J9F0FC!ѨK"h42vc2CCCC2M+:*@Hxz(R(3(`/(WKS8'(S CA?????????????KAiBB??SA[A?D??kA?????!DA?AA)D??3D18( "$A8((S B???A;A??cA#kaQ###\ 4 "#IF20x ( II CKXa/#d2+#42'#2##2#2#2;M$jh4U9HD, c#2232#2.K/!@FF# ;0;<@FB02< ?߮/!HFnF#;0;KXi^6,?g!FH0a2C"Cu H(HH(H~ 9es"J |"|"vo-O]L  -#0%#FFC_ca#FC_PT`JAFFXOiA@ aKh O OalRFW/!(FVF0FP `KOaJ fPFJFpPFFHVE90FF(2"hlOaW~F(@ۀIl y+c+P+VT+_yKyIFyH d*Q"OOOOOOOOOOOOOOOO1PO}POPOiCa[iBaYHQF09iB iBiB?p:x*?::!8FlFHI "+CH2F9F(!9F( 1F4#h 8I e*` x 4In)Qxo)2*`#0J`0I(FFP-JHiC(J(HD#0%K%JgFHF ]$iI F(_I F(YI F(SI2F "p` Pg ":"/T&"poB~'͹ dOc)F"F0FXCF*I"F )J*I 밹(F(M F0F#X+FPFEF?q  I(FRF 0I"F(F F D<`BI"F }a; 0!+I"FJUm- #F I z"zd@"edA(-GFL FKN'KJ!F(FC+G00DH4'CKh ! (>I 0;I O =@HFy(m(P(f(n +R#SRSMRRRRRRR'SS #`#!3`1#"2p hT w"9FK HTT FFPF EF爢"` i~'KJ-OF F ` |8# # L&7F H#$f00`J)F@FC;F00#Hj&7FKh 0ch#0! (КI #hI I O EKh+ PF z(O(B(eF(P8*(S 9V{T{T{T{TMV{T{T}V{T{T{T{T{T{T{T{T9UkUUU{TU{T{T{T{T{T{TUV{T1VAV{T{T{T{T{T{TYV_VqV#0PXIXFZ A0DTIXFP(@CQI# b 0 #FKH>*#II0XF2#0DIXF(#0AI #ZFc (!(@Ӏ-=X%0$'F&FF 1v(l(H()T(}KF PF J0w Gm8 (S iXXWWXXXWW)YFiJAF(FBgI hB+@SX" B `ZX#_K `S )XF (0+jWIZFR sNK "h Fx+(OsswFFF *0gjO ZFYFPFUv??FFVh+RZFPFEFF.IRF x+<h+?s3m2F "I[F(x-+1CG FP 7 IZF5$0BF)F FG0 F ~':` ܷ:: ;H I H HKI3F]ٿ"-OS}4 F!O rHF  P` OO8 D    ѲH0&ѰI TK%hʹ0&F 2P5Ŗ583-H0ѝIH0ќIH`.YњK/OMI`H`e>FKMh J8FD?FCяK,O0+@^@Z5+@UO Aћ5 +<Ѹ+7  # 3` *FcKF84F(@TsJtI qhrH6hz ܻ`ܻN}JܻAdлC XFB@Ԁ|a#*Q"]\[\[[[\[[[\[[[[[[\[\\\[[!]W o@! "!4J Pd+?BD8H$\iccui dm I HI@HH8"} I H H I HK I3FH]ȼ,@"H" I H H I HK I3FH]\"}d"LI kK(,d h(d0I[8IT@ IFQ0c8U@ct" 9)-G (dHcH@(bHaH! (8D/! [H F!YH XKYIVJXK( FWIWH "0 QHHH! ~0 MH LK"LN !LH$O O O '3`GH#"!%#AH"!?H"F!O3"!33# 2#"S ##!"F *"F DDf"F ` F x(F t r # #! D L0zh=%K0h]`G >"Vh'j`1mq)"-OOKLFFEFFO6 J9FXF2CѡKh  -ʀM+h ,h&4khBZ?+ 5u(f(F(+R(g8(S cccccc?dccccdccWd% h  "hwI  hx#+ hJ h " xF+"hkI 0 " xF+yhw hF(q"haI h hx#+ h (?a h " x+?V"hTI 0 " x+G#D#!F젹!FIHTOGHTHDH 6 4=+?Q(FW"p F  CtQx9xc*p*b* 2IDT F?.#DD*I DT# MEE--O@ F!F@FF +!F8F0(h+ I:FLs~'/r` Ľ"qr%r /27eK`DcKh x+PFD]I =I#"DH### h"5K-5I#oBI |0 ;I#T4##$2Zh* ""$ t"X 6!#`<$_QXB@OxX<$!HIh0>IZh B~'"o ~~~~~s-a>Tb@"s} <4Zզ&Hn -лr-o"!VM|"![y4Os4NV2CV@Fd0ObFO6%4KV#*s@+O @YF@FCFтIBF\Vz0IBFT4+4FC$[K[z. 3#bPiK$z JeK(q CdI氨BFOaTF(`IBF TFOa `V1FOc(HFV^TJTIV0VhpCONI$B!HI !FDI"CH b 4 JF(F .K$Rh$|0H1FM0',J1I".H iIF:( IOr4 IFF( @ J "I C04$;#X4 3BH2h*$I% *B*#C%JIq"@"1D\"ZlȀ߀ (yuIHFh#T4SoIHF(nKnJoIsT4+jIHF(hK*"bKS#Bq  ]I0۱a`[#KC3 F! D0@؁[# PI#BF +CbA li FIFz0GHAFOYIFOpK F(AIJF JF!8JR2JC"D$*5HJF[FAFROu{JZ-M0$$4T±+@)t$ERF{ FJFlC!I k{+F+O0$ܩ+Ob0$@ƀ0oˀ$_CHORp="?@" c~"DJR Or 򄀰r 򁀰_r~OR0$B+0{ 4S$O0( 44#0444 0+ @4+#vJvIwH #@4,4K$4 *Կ,4"F1F@F wNЦBI F.kh+? ,aXh(F`=,@^J#Fd! la ,`R(cVI ,bX OrObOb!OS$4404$4}JHObT4++r0FfЯCHJ  @"3FTH'0(RJWI"SH jQF.( JOr4QF:( 40CJ HI C;`4+h4 BIIZC=Il;K0J;I.N@*2Ia0* $0Bq /Irh4 $ (F0@# "I#2Fb+ciat(F9F01FH`OQ FI=FpIRFph笌D"Z".Ȁ߀rH c~"$ t0w4+PHJF;F1FtOsw5XFJ| $ 4*[+;F 4Y4+RFPF FAF*F0FkB(F XERFw(FYFJFhB(I gwIFOExOc 4 $$IFOPExOS+Х  IFFOExtIFOPEx+o笁-O|MFFh"! FJAF(FC ѮKh=-@$@85(S yՃ݃  !5IQg}Ä߄pKqIhCs#$0ojKh`khKjIh3cdKh v]aHO2cK!h`0Ca`0MYKh#bIWKhbEUHOrXK!h;PHO2TK!h c1KHO2PK!h`c'FH"LK!h}8AHOrHK!hr`FJIFPF^CHh @  +H +z(uIC84(jP;&5:T[H_cShCC`"x ( XI hCc8;C8;whCNKh>oHZJK x#  DI8 RS+ ?Id"x ( 7I< 7hCshCSh0I BC@`-Kh@; hZChC{hCw8;C"xF ( IrOsBIhCUhCQ{Gz?`RMb@A#3Mr:` 8#\u~'hCC$ "xF( yI#",xC+ qIKoIhoJCcoH`# hiIhkJC jH`# hjeK x+ ?m _IOe rXI-<;+hUI$GQ VQK FY`R A0 8`( {:(; EIhHCCH&2k<+D 02F=KhBhoCB0FOs6KY  b5Hfd Np@`OhCS`h_ cˌOs2a&K8$l`2,F6`&.`p@FIit (6IBF ,ſFv`&&eA~'L#*#-h#0(#` h# 6(hZ@K@ hFFK,@πBҀ +΀I1" 0 / . - ,+*)('&%$#!#FFHBh ђHxB Z>8;#"Oq0уHd8;#"Oq0zHR8;#"Oq0pH>8;#"Oqr0gH,hՃ"x+"y+"z+d+{+"+"+;!'xy;#z;(#;+&QHRI0*"!2(1JIc10?%GH @+FI!23Bؿ#T@LT2D*h>H4DD,E0KBFU6?+223LB@ph_p'_rAـK)!rH`aQUR !" "(I0K0k K& "!(Ih@# "!K(5Io z0###{g @!#P#%# H3 "|(Iܻd &zkhIFHAKOqb(򵀻KAOq&TI `Kk"k2F(1 k#kKf4aM'#f"%f)F @<;B󊀤I 2K0@Lvz A :!:۔I @T\Vz A 9!:I`"2BTڵO݂I`o ~KiKh>yI`] HL T@I2"oI O \0CkIgJSiSSa+?6fIaI 6hPL^Kxp ` 8ؿ` 8@țHI k; IF( {*F- M>h+HHF ?I##p+t h++HF1H1H!'I 4t;$JxO  ENh  AFF H*d2"B+?h-C6?8~A@@Jh#mlť#h#X#X#8#g   #0+@2B`8‡BKd2C  d2h?𽀚@񢀨hhd#OzsF\XCH Kp @@  Ճ ݄8F!3"D3C3h2[陓2[EyBH FzF0F2Z+O(+Z; hSgHC;6'+P^KF;+Ch 32ZHh QK/ h h3SsEbF”F[PC U0w;hC AH;AF@H'h?ԇH FzF0FL' Bh  *K V ہ/ ) HRK 0BE܇zH FFzF0FJ!hBDzHD x'hchB'X#v&Q0#g #9ѝHX7HR;+Yd #2F9F(FR(?ix): #%')+-/1357H" HHHFH1F(F#0'X|H|H|H|H|H|H|H|H|H|H|H|H#2F9F(F (?wH#2F9F(F(?ix) oH(FmHmHmHmHmH#2F9F(F(?qFmFcH#2F9F(F(?|^H#2F9F(F(?oXH#2F9F(F(?dix)RHqRHaRH_#2F9F(F(?Q)yMHa#2F9F(F(?EHH#2F9F(F(?:DH#2F9F(Fy(?/?H#2F9F(Fn(?$;H#2F9F(Fc(?6H#2F9F(FX(?2H#2F9F(FM(?)x-H(h1F(F"C` ! 2 K e w   '!   !+E*IJF@F@'HD :"HJFAF  'H2D |ܪo SC  H / HFO0ջ"v"#~""""-OFFnIxF-+4 F(:ѦK$"`O FFJ1F(FC7ѡKhBu'>3FS}[(FHFV)X/DDd2(Y HIF ($I F(цK"@Z`d+ '*!$DtDOvKh RDdDD4D$D$O O XFXG(FiI(F %)F FBcI .ѕzF(FphUKhb "!QHH3XI2F HVVN[h "!+OHH$RI2FNHH-7OI+F2F H>MJNINHH#JJ#JIJHH2!F! ! ! ! ! ! x08I8I2F!O0l0h+2Hp1L!hFZ'J?F(FH*I"FF > F &< !O0<0ph+H .H)F FH0F6 $o` fxb&ɛNߛ(-OFMFRHKM(FHwhK(F+`;x-+04GCF88F40G;F! V+8LFFO D+?S;pD>V?D;+Ѥ NFC$z0~'8%RxoJhi t+#kbI (F I (F Ht (c~H|K>$3`+~r+XR+i+G t+x+B ) O V)ObzPFFЃ C#+d0VBF;F  E ki+ j)JLr:HIIHHHu jAIDHCH"#*2a  h0%1-?s FFHmk(F#1FC(3CkC2 v"1F(FOn%<X-GFh FpL')FJ0FA ѵKhBv GIF D(DРb++R#'7EKS?[cksKh 6#$6#(6#,6#064v#6#86#<6#@6#D6#H6}$&B4&< C"<&,&28&rHr4&r<&Z0mKmJnH)FF`U#PJgI(FGz(ZeK #D#xhaI(1^MOjO W(@E #+p#kpWHdSMP6jhCL`xFOH\HE(<h1!oF(f.@8CF@*?HG V+x++ .F0F37HF(F !8Bak,Jhkxh320Z<#XCKZ`PBD2m 620 Ѹ:(3x8 !.K/J/H.O!8F+I:F 'D0d>"h"$+?K J`.#%~'+` +pmN95#%g -CFF0IFFPLJ9F0FlCbeiݱK R.@3B-@M#j+@Ia((t(<єKi JhaJ9F0FBBяKMh6.,iTI Fd(I F^( O 玱+i{ BF|I}H|IBFzHt(o@(A83(S ǺӺٺߺ#/z(Fci+BOsci+;#caci+4#ci+.#ci+(#ci+"#ci+ ##c`#a#a#ci+ @####`#`##bKh`ci+Osci+##i+ KIh a`(#cbp(%D` ~' ( g -:chh+&i--iI0F,XgI0F&0fI0F"( -c.--Ѯ=-?ͮS%wwww-W)P h)F(MI*F ~B@-Ѐ-i#"jih(cAF=Hi##"jihv(zshW)W)cj+?S ,eW)`" B0&H'I FF0 K"T(X(2"H!F- I F(6K"h(0$TO%&|tz/4@g g ` =Fh@4D+R#is{go ;EsMW}K"(HK"X(T(K",K"!Fh"K` #hx+?KIh K,B,,2,~K",{{K"H(v yKFhuK,"`L``fqK"L(apLObrH!hoW? $hFmI"FFeK"P(IdKbLhgIp(=dK88\KhYK<(2WK"T("X(*UK "!FhOK( #hx+?LKSIhHK"t(HK "!FhBK( #hx+??KGIhj=KhDI "  F%7Kh*=IPFN`x+0K:Hh 5D-"(FE0-H( 5Eo K",K"L(Kh#FK"`(d(K"L hMK( "hI Kh?)H mHKHhI*FO%9~'`eX%\g z~'g L#H<I K=I G@!h0FF F5FKF:Ob'F F FLRh P|Px 0,8P+H,*LK",+$O%bjtv&Ƌq\T\%-:F)F0F,8+I= ,8+О-CFhF^LhI1F(F#3p2+Ā"l!򱀠I -8 v(;ћI l9(/(,qhHLv(3331FJ(FAѐKh/V#PJ+xh320((F(هI" Y07 s'O )FHOr=? |K|J !4 3xI vI tI |rI x(F% oI .p0mI!lHlHkK(F4NhH4KfMi i dI(FaI4+I\Mi(?Bl"!(EVM VIO,ť 1#c1ŲPl0BDѹAŲP(pO & ~` o &"Zjg ع&&qeo 3k(QЖ BѶ0[ 0 ( (l "\1+НK J (FF:KH0BŲPm(FX0F[;h530B0300l "'1#_ZFtI(&s FF?IF=K" =I(F (;I(F(@6K"``;n(b( 9((0(03J3I4HX3I*F"c +R#V(JIH0 J08`J!F0FCKhBKh`Kh K"` K"Z`jF!  hT?+64\&>4=4Ng C4w4` FV;ELH`#` #`}Ij##a zO`a H  Jzh mIJ#;`8hjKkJ(FF d1- 3hx-*+*[xK0p lV{=[I8F(8F WH =axCUH 6a SRKaRH -a JPKa!j!!NH iF-ci  a(  RV = R F@Kh;?Kh#iC>H=M  +h+9K9Ih )(6H! (h(?? +Kh#c*Kh+!)HV C * e F(N3h+ (5`Kh+ tcp&44S&O4X4zd444&tT&4DS&! d58T&Y&$5lT&,T&-GFuLFh'vsI Eg`qJ1F(FC*oKbih:CV# 5O(h(=U(@bK!hb`HJ(^I u(`(G(DI(FE(;~WIFFWHZ a+R#       )     /hC`h#s8K/Jh+Fc`#`t##aqĠO 0F)I@FJAFHFV$K 'hOhCsKJh+Fc`##H"F(?:H5#a2# H"F(?*H@BidPt&& ` Hd&g g ~'ȓ>b-OFF I(ڠI K,FĕLKF{HZFHxI8 D(juKvIvH:F "x-*hx-*axeҲ* բx*i)k)e)fJC,eJeJs( P( E(I(-(:Q8"(S {uO L#I5K6HhC2K4Hh0Khx^-:[x+?6?+10)Khx^.+[x+?'?+$!!Khx^,[x+??+K hKHh#O O %&$L~&u'o ` u# # # ~' ܀4I0iij\ `0. 0*9 2(F"F1F!L"I,",B J! I:FH+H"!=H"!8H"!3+`0+ ii*ݭ0\0 I0 K Iht@x~&L~&g gtK\{'-O$FF&FSJ9F(FC-QKME..K0FC9(8,D FmFM  %EIF(6W) ^0=W) >I g( u(G(  `3x+@#x0x0F 0.I2F jFFx+-'I Z5K #H0M(F0I R4@F0I6PF`0IP= (F H$KJ(FF+F!F F&"FP` WiHrV~'-O#lO$kJFOp;`FiKjM`jK`jK`jK`DeiK!FOrhL`&hֹfJ#fM$fH5eJ5eJ5#C(raIaH F^h0BhF(F4ahXm(T D(@f(BC(EQISH p(Hr(OJIF@FC%{'KH :X pCO&+'s9CHF(;O F8{+ѸO9K"`55K6I`##`Ԡ/LO FO FH'I"'HO %L h\F h\#F](>IHy&h&^&&&&&34&&/ &&g p ,&&&2u'~'4&br(b!=rHqI >oI :nI 6 hXa@jHt@ # D9F@ D5F-( 4##`(`V0F T  TfWH # T  .I T h.JO@FDE~(FD FD  F@F DDH"!F #;`@K`" ?K`b:Kh)[ /.'5K" `13H  T !0FD9F( #XH#A#3B #2FAF #O3?F XF!FXFd.F|FF{U)DT)D  s  &HT&0&&~&9-OFͰhLF&O3FF `AFJ8F AFњKhB!ݹN"HFFHړIJF p-a-b=-   " 4z--4IoB#H#" h#R3~K|IO2oC|H#" h#<  sKh`6OF[ ( 7 8F1FFHpC_(##O gJ#aX)FabI0 ZRF(F&00P##bCF(qWI. 6ѹ3JFRIPFRQIjFOI JFOq0F( "0FYF0 "F(HF(?ID{0F(:I 8I 9F0h0hph!phIF8F0hph+I+JKFF(?l(I PF(%I#IE)Fd!FX#|IX# `B'rc` 5~'gcg ht@c}c9cccccccUd d!d>I O03/1F8FH,O  BF(h+ 3-IBF|h+ 3)I 2DBr2HFFU  Fd"h+FOqB ##`{нB EFBh+E 3! \0FD{PFXFF Ad3d-O(-OFF3}  0LhI F@HH 3}I F2(IH.H O(r!% F^ K!(FQ01K"h1O31}3l3,130(F4!F0 4! 0o OE4#FF<11F@FKLJJ0CXT32(FD0B81C3816@60 FQ\!`1:#FF F9>F(@<1@02BnK+!nJ F381C3810CE@܁'dMV((M( 6(?(y4(O ]K'N8(S /7777 f('j8(?g(?dS '77#77777777:Kh01=@C36Kh*@2(L%E+0K''<1%Cc<1%e###<1?H%O K'K'FCF! F9d(3<1?9H#^j&jjiJmmnP Kii 6Ln g~'yggg` (@H02B)F F9{# FFV!9%F(FCF! F9 : щH^3 4'0>#X 8F40~IH6 F6x1+@ F)F9;CbC^ F9pCW F6 F4kKhBCI<1@@,B")F^0@YI[H6<118!1(Q*/ 4T*/@-@ @*/*/*/*/xGfxG5xGhxGMxGzrxG秏xGحxGxGxG^xGuxGxGrxGwxG磆xG΁xGdxGxG hxGyxGCxGxG瓆xGxG灐xGُxGt|xGSxGxG5JxGjxGRxGxG~wxG[xGxGxG xGxG@xG%xGvxG6xGoxGQxGxGIxG}xG籌xGxG|xGu xGxG8  xGx)" xGHxGxG焐xGxGjmxG!xG3IxGxGIxGЪxGʤxGPxGȷxGxG xGxGk,xGxG:mxG-xGxGxG%ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xaddress:%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics formatsector sizesector size `%s' is not a power of 2.maximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectorssectors/track%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u%s: can't write sector %u1601803203606407201200123214402880usage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s/%s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s cannot create file: %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes%s%dSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptysystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d I%d %d ioctlatalkchangeexpirehosthopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20251206NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsSHELLCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxypromptrpromptsslnoverifyaccountbellbyecdupdisconnecteditepsvepsv4epsv6featuresfgetformgateidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspagepassivepdirplspmlsdquoterecvregetremoptsrenameresetrestartrhelprstatusruniquesendportsitestructsuniquethrottletraceusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. %s:No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandsentlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberhdraectbdchfesprdletdvcmiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zeroone%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecremotescripttabexpandtabverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderr Terminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesAllSomeokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 11.99.4 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.4 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.4 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.4 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.4 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.4 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.4 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelUUIDGPT TypeBootUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. # sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogLC_CTYPE11.99.4evbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv7hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*udf%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbetcgamesgpufwmanhtmlrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub/boot./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.confusr/X11R6/lib/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %sraid%dvnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2d/%s%*s %spartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullv7sysvv71kv8otherhpfsadoshfsfilecorentfsjfs2efsnilfsminixfs3vmkcorevmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitiontc/etc/group: /etc/master.passwd: (malloc) Error in munmap(): JjPUPuVvXZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrldigitgraphlowerprintpunctupperxdigit%s%s%s 646towlowertowupperASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d -?y WA  !)#x)#%&*Ê+Š+Ɗ.̊0Ҋ 1؊ 1ފ 49;;]?8!N=RCSeW Zěa cyg"el/yl^l<lIllUlalglśzYra%%x=w=]A}.ƋayˋЋu8؋U2U6pushdnepopdne  \  w@@I  @@  >``   Q @@؋! Q @@ unblock and -DNO_CONV? `<0" |100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverwrite %s? override %s%s%s/%s for %s? rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directoryDISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# unknownline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/tmp//usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXEDITORmalloc-c/bin/shre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesAutomatically adjust partitions [%s]? Invalid answerreallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tableQrounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] Usage: %s device %s device command [arg [...]] Available commands: nonerwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grewfalseArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tablefatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console-sh/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEV%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsuniongetmntinfopuffs|%s on %s type %.*s: %s already mountedroupdatemount_puffsrumprump_%smount_%s-oexec:Cannot create pipeCannot open fd to mount programexec %s for %sexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddennoatimenocoredumpnodevnodevmtimenoexecnosuidrelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsmsdoscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%x%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%#llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s???%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address boolquad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexNODESTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendormalloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREmoreVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<liLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticlcmsovbbc|^crsr[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE/dev/null.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%cSHELLlessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completedownexpandforw-completehomeinsertkill-lineabortliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdigitdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %s*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found/dev/ttyusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETAKiBMiBGiBTiBPiBEiB.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interfaceSTOP%s: waiting for an %s addressexiting due to oneshottimed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duideloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltuuidptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptreconfigurereleaseleasetimerebindpersistentinforminform6timeoutvsiovsio6waitipallowinterfacesrebootnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %srt != NULL&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0link#%dsa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASbridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink  E-ZAVp# _^F<>?PATH= t"fUdscmlr p"n.v 6b    EOF reading here (<<) documenteqy}'Y@FKPSYC`Y>tJ}-+?=*@̊0:@FLRYc@&&abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'H"0H"1H"1tH"8H"0A?H"0H"0 `H"0-HH"0-E 6b k g $ . ` !q                  88H9U'S!lV%:աq:m:  y |--i:1j$&:QD.k2k6qz:@DFNeTqHjm:\IGbaiQo )xjjr x|@     6^d:yAO, 9]Fw=]A #3#$3-2,3238#@F N@T@X`3JC @` #* &C$*C1C$0C8A LR[bjt|@@  u@  w ~@5=E@@K@S@Z@b@k@p@u@|@@ @@@@@'-@@$.4?FLRX`els})[`#3Fhu} 3.ZI7aE-6E  ).37;EKOW[aeph!&-4;BKR[`elu} !'-} 3.ZI7aE-6E  ).37;EKOW[aep} 3.ZI7aE-6E  ).37;EKOW[aep *=d   / K m}*:Ncy !#$&123456899:7;Q<o=@ABCD9EOFdGdHdJzLMNOPQRSTU!V9WS\]axcdefghip qstu#vw)x=Yj7Ss ! = U r           ; , O b q           % ? O j          - E c ~      # > t      -]~&[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]Ȝhnrzz|LT(,48>BN^jzreturning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read+s<@R-+wDzH.E|L@@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-R-5555566H6R6M6VP P_T@zN:999:!:5:C:IJزȸԾ(zz|LT(,48>BN^jzR<ݟ\@q<z<<<<<<=A= = = = > #>3>J>=`>>>>>??0?H?d? ?!"#"$?&"1"2?3"4"5?6"8?9?9?:?;@<@=6@@E@AY@B@C@D@E@FAGAHAJ)ALFAMWAN^AOnAP~AQARASATAUAVAWB\ Ba'Bc1BdlBeBfBgBhBiBpBq"s"t"uBv"wBxBCCCCbCoCCCCCCD"D:DWDoDDDDDDE!E1EMEgEmEEEEEEEEEFF)F;S|nQn- q+SS|nQn- q+TT|nQn- q+T(T|nQn- q+9TDT|nQn- q+RTz=rGy=iG}VTaT;Mt?lTwTmWC 3KOOTTyD<#*=(TTYbBRuoqrTT3Dh&TT\ M}-TT@Mjy֬ UU-чH+U-чH>@UZIчHZUIчHnmUIчHrTxU2IчHUL6 %?aUUS'@ )ѸUU*1@ )ѸU^1x )ѸUUST.qBHo6֯iUUy͹@Wbackupstore_gptstore_tblx@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps[[[setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatus dRprintallmaindo_setifpreferencedo_setifcapszih.yi|ZT$e^0&^tZxc>F\+epb4e5\8Ee8=eDeceneyeee eee@eeee e0e@ef ffff &f,f 2f@ dRinit_current_mediasetmediamodesetmediaoptsetmediasetmediainst(hG3h(hW>hFh d3hFh (hFh`NhVh@NhVh3hFhW>hmedia_statusmedia_constructor hhggghggghghhhh hhhfg h paddr_matchuu u_usettunnelaiZiXprint_link_addressessetvlansetvlanif@jjtjjj&setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchansethidessidsetapbridgesetiffragsetifrtsrpupxp{ppxpp`ppM5m4m5m-* |pppm0pm}* pzkpmmAmm}jjinvalid major numberinvalid minor numbertoo many fields for formatffs@Xe qzg@ Y *(9[n} @@|= &|+/7;AssBssss t t tt&t@.t5t:tCtMtQtVt]t bnorripbgensbextattbnojolietbnocasetransbrrcaseinsssBssss t t tt*@̊]udu&t@ju@tuzussBssss t t ttu u*@̊]utuju@duu&t@ujssBssss t t tt&t@ssBssss t t tt*@̊&t@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorssBssss t t ttdu&t@y yLy y@$y+y3y9y>yByFy @wwwLywww x@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecvssBssss t t tt&t@tuzu 4b҃ e|ń =s΅;mɆ3%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@eBvCFILNOqSabce.f@hikmno͔rܔsu@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h pp p p ` @  $1м|^t0 Non-system disk Press any key to reboot лC?;Ի73/ٻ+'#DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY-Zr -MyEsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefPFPF0* XXX,,x<<bitmask_printl,,|,y-,,y-,,y-,y-,,y-,,y-,,.-5/-/.-y-=-G-y-Z-_-1u-E)E)-i#-y---y---y---y---y-- . 3.y--#.y-5.=.y-U.\.y-{..y-..y-..y-..y- //y- /=/y- /X/y- /o/y-//33/y-//y-//5//((0y-0y- 0y-%0y-bitmask_scan+bg, ,,,hw.disknamesfetch_urlmsendrequestrecvrequest& $(,***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20240203  " $#!%Z^\`[_]aA1A1: SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data 696\ ]]peX&lu&&&&,&&m&ʍ& &&+&4&&=&&G&2&PX&e^&ls@&}&&&]&&p&Ďp&֎ & & & + &> &G&'&P&&&Z4&f3&w&2&4&1&&O&&N&collectܑș|zz|LT(,48>BN^jzNAME=rnhVȜmount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cdszz|LT(,48>BN^jz edit_fs_type_ext] + )0    Q   1L e  u edit_and_check_label zz|LT(,48>BN^jzdisklabel_freedisklabel_set_part_infodisklabel_write_to_diskijzC K K M aJ M H F L F 1H E E V {J UP eI G B %G N R T B B U F F -F H F disklabel_change_geomH:M `?8Fouter_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default&&,& &pm_from_pepm_whole_diskgpt_freegpt_create_newBa = = - u A V ] = y A Y m ] TTSn VTS>rTUUU RT!R-565H6M z\_dihnlr(w|raLTV>URTgpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eCSGFSFU0eCSHah!IdontNeedEFISS(s*K>;S|nQn- q+SS|nQn- q+TT|nQn- q+T(T|nQn- q+9TDT|nQn- q+RTz=rGy=iG}VTaT;Mt?lTwTmWC 3KOOTTyD<#*=(TTYbBRuoqrTT3Dh&TT\ M}-TT@Mjy֬ UU-чH+U-чH>@UZIчHZUIчHnmUIчHrTxU2IчHUL6 %?aUUS'@ )ѸUU*1@ )ѸU^1x )ѸUUST.qBHo6֯iUUE ȾEbCTA ,< O]mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_newH:GGe    I a  i  ) E = V I 5   e 9 E   mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free*************************************************************************************************************************************************************************************************************************************** 6ddddddcontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2!2q7qdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionEhb)yc0dDesf0ygshsi7j?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~Eo IfnRjn $* -@06JHFcs_pathbX bc_base_max& bc_dim_max& bc_scale_max& bc_string_max& coll_weights_max& expr_nest_max & line_max&  re_dup_max&  posix2_version &  posix2_c_bind&  posix2_c_dev&  posix2_char_term& posix2_fort_dev& posix2_fort_run& posix2_localedef& posix2_sw_dev& posix2_upe& stream_max& tzname_max& atexit_max&D ,  t!"$"*`#-$0$6L% B 1 2X  r\f&Vzg ^6  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported`]ZWTQNKHEB?<96 0-*'$!c3 b28- sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU JgPMmakech   #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef'++9L.DDҵ;15MS7) t:h%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9,2~nnw9kUnA n64UOKGC>:8.,11)15-1$1ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cyLLLLLLLLLLLLLLLLLLLLLLLLLLLLLyLLLLLpLpLLL|bwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K{aI1lV" =y`{J0bIc6G6{aI1lV" =y`{J0bIc6G6" 0C0*5J&(t}\l9j` j)`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc1:74_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove8_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equalsprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l ` F g n t__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_times   )'%] C A >\\\addcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareglobextendg_Ctocg_lstatglob3g_opendirglob2g_statglob0globtildeglobexp2globexp1_glob_globfree%%%%%%%%%%%%%%%%%%%%%%%/_getttyent_getttynam_getpassfd_getmntinfo##: _getfsspec_getfsfilefnmatchxgettype_getdiskbyname0%%%%*%%%.%,creatTLS allocation failed, terminating <R5xh<1  |4 ~R5KC5UCnn~;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkCof\ $u0LGGBBBBBBBBMa\aWRzupkfJunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedir  khwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rt K ip6_parsenumeric_filenoŚǚstr2numberget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchNexplore_numericget_portmatch_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi((!!((!!SPDGJM d'@Bʚ;__dn_count_labels*]BkB;%`(x&&{; &Ӹ, charstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton _inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl>[d54ؗҜ<3#I9=D2[%Cod(h4)$ _posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internal_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddrgethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseeko_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatchvk^>&"ufTO/u %02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04d-00mn /usr/share/zoneinfo/Etc/UTC_strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf333333333JiJJ yYZJjJJJjzZZ gvP:MNNNNNNNNN@S4mpCbe0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponent[dWce\Q_strndup_strdup_gethostname! !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZbt_rrootNEXTINDEXbt_psplit__bt_splitNEXTINDEXg jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG&# ifc`DM}zGG2,l:KD><%%%%%%%%%%%%<<<%%%%%%%%%%%%%%%%%%%%%%%%%_getpagesizeqsort_r__sfvwrite__sflush__swsetup*!*!__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocs# dl_iterate_phdr_setupxplT444444444}>>#g0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddrE"+18 _nsaddsrctomap ]:[=             VFFFgj          DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerrF7Z77<7O__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitN??S??E?NEXTINDEX<YY_`Q```$,48@HP \ d l x x N`'Xs<   `   ( 0 V 8 < D L T \ d l t x                    4 <D x`8 $s Lz ,L hZ &   X6 { D   8 L d  6 H \M    2 l 08q h     <0i x   A ,, hh    X X X XX"  $ ( , 4< @D HL P L  .T X V \ ` \d  l  t |              0 00 0l  XD9`h4pȳxU D D  D        TdT_p|T_  \p\ D#D#gnts<[8][Pmkrbmnpkhji$jXjtcidؒPĠ4( ZD#D#yekdH,`$atad(loob0й8    yara<tĽX!Tt` +++++ ,(,4,L,X,p,|,,,,, ,, -- 4-@- X-HL d-p-------.$.T_<.`:d:l:t:|::::::::9:9::::<Dd9p9|999999999999999: ::::$:0:@:L:\:\;`;d;h;L;P;T;X;=> >>>>$>,>0>4><>@>H>L>T>d\>`>h>p>x>>>>>>>>>>>>>>>>>>>>>>>???? ?(?0?8?@?H?P?X?`?h?p?x?????=????????@@(@<@L@X@d@p@@@@@@@@AA4ALAdAxAAAAAAA B B4BHB\BpBBBBBBBBC$C8CLC`CtCCCCCCCDD(D` | *)*D*(($)(,))D)*D*((((,),+))))0|MdOlOOOOP P~ ܺbjkjc"fhkl"m4o@oLp]prp{qru|tvwwxxzzBCJOŻPԻSۻTVVXZZ ")> JS [ Ћhx(}5a#5A=ͨ]v(5#9=ͨ] J> )rh/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbint<"}-+?=###%%%}PB"TB"aEV e(F-Ii7LDlJmRC\ncfjppwb~uqshvVVxD"@=d ls-2E#Q4=63,4N+7{44'33t_|9!33=MAJ5H 6F 69F 6IN 6H  6EO E9G@JAEX^ ... ... ++[--.&77Z<&LLxMM{OOx,R\RjRxRRxL%VWYjZuYUQ E[ZxAabCdhlNsuvW:w:z8@HPXzdt,d eع&dtd`Qeعeعd,2dTT>d|dUdt`dX,]Z[X4a]` tfdʾ"mdʾ"d <`t@pbpbd|Z\|Z1d\>\9d>tZ>~dʾ"0 \\Qe|ZtZ\c cF\ F\E&^ &^^ ^g`gghhhfg gffZiPh|h1hh@jjjj tj~p(Dppppuppzk zkpp-5m* 5m}m* mMp pp|K sesesqs!&s-ade,sehCsު2s8se   &d\jZzc J&^tZF\ !"#N$%&'(&R)*+,-!/*141@2L3U4Z5^6%%g h,D,#,),0,6,<,D,K,Q,W,`,. (prog_root)`x%r iy`9_ii_y>tzl5wxb{f=l$e nʫo xiq}  }&=}ly,Ɇ6h;_@!keel:iFQx_KmPaVAuo\ucan%qlfu%qor _xmƋ%af%a1o{1{20m|ooor!l؋jk^y `tyw !BeeMo=x%v}`j aw:h_}E]_ !*i\!^i xi0asjJ&e@$!D`p \002<<DKR!Z <W>ut9pA| $C%+%cA .$ $ 2Msf?s$#&E` FPcalsh& !"$'(+-.03569: F J aT L&X /bin/sh4 677777781(811888@888K888R888^888e888p8{888888888888888888888888888988988988988'988.988:988B988N9U9_9f9n9w9~99~9999999999999991:7&&:88+:{8>:8j:8:8:8:~9: ;;9B;9^;~;;9;;9;9;9<_9(<n9s<D b| $z  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJT T T h h h T ""h e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<AAAB is a directory is not a regular file (use -f to see it)  (0EEEiFE;E S7E E E E#E2F8F F.F :F([`LFXF!dFmF9FFLF&fF)FF5FeF:FH%FF6t_F4EF G+G,%G-4G.GG*TG]G?=mGEtG/G/G'GF DG D_ EDiF DDD DfDD,EE6E2g E E 'E1EWmkRkRkYcWbkCkc kG ky wb YMYrWcaH! T&OOOb@! @HT&OPB8! LT&;P`Pc0! T&PPPd(! hT&PP(! AtT&Q*QD ! (?Qe! pT&LQfQzQf! @T&QQF! lT&QQg! S&R;RfRh \T&RRi TT&RR Sj 4SBSJ !T&OSmSk H HK T&SSL T&SSm |T&S TTn "PT&%T```` `T]=]H]] ]k]y]]]hpppWubQrR)bS)hTXbeabbO?cPcQbRbSbTUaV hxU][]yc]<_p= p>op?prV]-]A])__^Ugefqr\Sgp___e_gfQ_yc\T\"\2\T\rV\\\e7p?pGpOp!Wp!` `__pe`Q`9`-quqqoy`q]qqjpko`qrohi\}\ p/poa\'po``pEqqpoeaMa5aaa`gg`KcpoQdAd1daddddddddudI\Q\Y\;\uA\Ae%eedoo[[&e'ye(ke)]eeeacee%ef feee[*1[I[a[y[\[[[IjzPعo  =!!M"]"o"""""" ##$6&}'''65'''($(/(>([(u(((F))) *+*R*s*O**++ay++++++,<,M,,,--'-P-..o///0W2~35,6x78Hu88B99`:t::::`;;z~<<E=q======>>,>9>e>q>>8? @ @-@Y@@@@@0A@BB1CC$DkDDDFGH-HHH6INIvIIiJJ*KKKKKKL!L'L@LMLaLoL~LLLLLLLLLMM,M9MGMSM_MmMMMMMMMNNN,OOP!PPQaRRuSTsTTU(U2U:UDUNNUWUfU~UUUUUV)V6VBVTVnVzVVVVVVVVW!W@W\WwWWWWW6WWWWWWXX'X7XPXbX{XXXXXXXXXYY#Y,Y2YCY_LYdYnY{YYYY~YYYYYZ ZZ)Z8ZFZUZ [/\a]^^___`/`A`Ԃd`r`v`{```````aKahaaaaaab4b]b)cAcd)c#dIdhddde(eVefeeeeeef=fffgigފwgg h[hhhhhiiHiOi]ijiriiiiij\ WX~jjjkk?kYkgkxkkkkkIkkkkllXosoooO6ooooopppqqqqqqqqqjqqrr,rXrrrrrrrsȓȓsss tLtntttu@uEuKuuuvUww xFh.xFxpxsx~xxx yPyyywz-zzzzz"{Y{{{{|7|T|j|||||||||||}&}7}T}px~~~~~~~~~~~~ (2=O`o6W!4ITfr}€̀рր';Oр6^i~Ё؁(=OXVeqł҂ނ3Tp"8jtֈt'MMQrTIF/Y׳u hvL v }`d0 ħ10̧&ا'ӧ(ܧ)*f+,.1/ftpݪ@HrV@٠ %2=LX= 6>> #}? ?A? 7@ > Qu= A; B; C ; D = E ; F >; G T; H a; IC; &Y9; &%; &]_ c b W 1uW 1ef uW KYhuɳֳ]1 \ќ ] \ɝ ?"@0[D\N\^]s^~^__`{{|}}~  -dd-ddTdd:dd:dd  , @4 @@ `H P \ 0<DL#T#\#d#h#p$|$$$$%%% %%&&&'''((()$)0)8*H*T*\+h+t+|,,,,----...///6; ;,080D0L1X1d<l<x==>>?222333978:(444@4H5T5` h! x" # $ % & ' ( ) * . + , - / 0 ,1 82 D3 T4 `5 l6 x7 8 9 : ; < = > ?  @!@"@#@$@ %@,&@8'@D)@P*@\+@h&`t'`,@-@.@/@0@(`1@2@3@ )`4@(5@86@H7@X8@h9@x:@*`;@<@=@>@?@ `!` +` ,`( "`8 #`H -`X $`h .`x /` %` C C D D E E F F c c d d ede # #, &< &L 0\ l p t x |                   0<d h l p t |  ,8 < H@L@@QX`hp|   @@@@@@``  $@($ 33333333T_T_****+3333d8h8l8p8t8T9UTC33hh    E + 33d(339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sžb (b b b p 33UU33UU33UU@g 8Dc g 8Dpd g 8De Th @g '^P^X^`^h^^l9x9x p^X  t^x^^x   @ (333333333333333333333333333333333333 33 33k 33 33t6t6( 0000000000000000 (3333R3333x<33`m hm pm  (root)`33̽CpEpEpEpEpEpEpEbD8pFHJLLo |4646455d5t5H0\0`0h006007,222704h46h13Service unavailableDOA4aeabi*7-A A   "D;87xܭoAYr+\`u(4$!!AUE"P8 ܼKٝ7+/Svˠr5dpoY8"RywOOv>(+ly1nt&?~7Fr'"nbܽV-=ޟ|Ay׼2\ޜO"\g<ׁ;Z|z 8{gY{{،̯jM$׻uQo-jz.emD\)EwFzg>>D\E|,c=8ۋG|=F|is5+~ߢVG=gXԌgm?_Y0A6H7#_\ۑ#YGӵȧ];۽w!M~EQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+Qramdiskbin.debug-a.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf.gnu_debuglink / B0H00aPdd_Vdd_$b_g_t  ~(yHHxo /o /Vd(/p/5/22MSGTXTS627 5032 5057 5074 5096 5099 5104 5112 5119 5127 5135 5138 5141 5144 5148 5160 5169 5182 5211 5226 5769 5803 6486 6774 7482 7538 7612 7708 7883 7906 7929 7935 7944 7966 7970 7974 7977 7980 8085 8288 8527 8968 9406 9441 9456 9468 9474 9486 9535 9555 9595 9612 9629 9644 9691 9729 9777 9859 9983 10119 10160 10198 10235 10270 10280 10329 10479 10485 10490 10494 10514 10624 10644 10650 10664 10676 10687 10724 10758 10782 10884 10921 10943 11042 11097 11155 11166 11182 11234 11402 11609 11780 11844 11896 12167 12716 13244 13675 14013 14346 14459 14474 14483 14643 14814 14964 15128 15151 15175 15190 15265 15405 15582 15737 15749 15829 15930 15976 16002 16072 16083 16092 16105 16131 16146 16162 16175 16230 16241 16256 16460 16693 16722 16737 16806 16880 16953 16983 17021 17075 17529 17555 17584 17688 17794 17979 18091 18206 18310 18997 19256 19396 19432 19602 19643 19779 19802 19839 19884 20135 20231 20285 20384 20395 20432 20469 20496 20505 20539 20546 20571 20598 20633 20647 20661 20690 20704 20721 20730 20752 20770 20787 20798 20817 20843 20861 20884 20901 20916 20931 20949 20976 21003 21025 21064 21082 21114 21342 21416 21459 21505 21652 21808 21852 22131 22158 22517 22701 22853 23034 23181 23339 23360 23408 23418 23426 23437 23448 23458 23465 23480 23492 23529 23559 23598 23651 23709 23730 23737 23756 23777 23784 23806 23828 23848 23870 23901 23938 23960 23974 24020 24049 24083 24123 24158 24186 24234 24243 24252 24257 24266 24275 24292 24296 24301 24307 24311 24349 24358 24385 24405 24428 24447 24474 24496 24528 24544 24549 24559 24582 24604 24621 24638 24651 24660 24669 24675 24702 24709 24733 24754 24778 24791 24810 24835 24858 24874 24880 24892 24922 24930 24970 24981 24992 25003 25020 25037 25051 25068 25284 25588 26036 26252 26516 26788 26840 26876 26912 26963 26980 27018 27032 27039 27056 27059 27064 27073 27085 27096 27105 27126 27168 27206 27222 27253 27278 27313 27369 27409 27430 27450 27491 27520 27568 27801 27836 28043 28062 28099 28160 28198 28237 28393 28408 28454 28502 28525 28561 28571 28581 28592 28597 28660 28708 28752 28813 28846 28947 28965 29104 29126 29249 29263 29273 29296 29401 29457 29573 29604 29609 29635 29674 29684 29727 29737 29753 29768 29786 29809 29839 29860 29886 30083 30126 30130 30136 30142 30147 30158 30172 30201 30233 30245 30292 30342 30382 30409 30425 30434 30477 30483 30491 30495 30515 30532 30544 30575 30831 30880 31456 31483 31515 31543 31595 31601 31607 31612 31633 31649 31671 31700 31841 31975 31988 32124 32126 32128 32130 32147 32160 32178 32205 32209 32215 32220 32228 32234 32274 32276 32286 32301 32318 32352 32384 32422 32451 32480 32502 32545 32571 32615 32751 32753 32833 32879 32927 33032 33134 33173 33240 33247 33308 33372 33376 33383 33505 33574 33862 34000 34141 34222 34269 34275 34298 34344 34347 34373 34416 34481 34543 34613 34681 34774 34993 35018 35022 35058 35076 35104 35146 35190 35254 35304 35380 35402 35454 35498 35537 35571 35601 35632 35657 35666 35678 35686 35697 35709 35728 35752 35801 35818 35842 35885 36207 36210 36224 36237 36249 36256 36267 36274 36281 36290 36300 36317 36333 36383 36391 36399 36409 36420 36438 36455 36476 36498 36507 36517 36544 36550 36560 36579 36595 36613 36633 36642 36653 36660 36677 36696 36717 36727 36744 36750 36766 36781 36796 36817 36839 36858 36868 36873 36878 36896 36915 36934 36940 36959 36979 36999 37017 37022 37028 37045 37061 37082 37095 37103 37123 37147 37164 37172 37183 37204 37210 37222 37244 37258 37267 37288 37306 37315 37349 37372 37399 37431 37454 37474 37485 37517 37533 37544 37557 37580 37602 38110 38140 38171 38199 38213 38414 38636 38803 38890 38907 38925 38942 38971 39018 39029 39048 39070 39149 39341 39369 39487 39509 39650 39669 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.99.4. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.99.4 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.99.4 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.99.4 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.99.4 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.99.4 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.99.4 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5766 5793 6359 6659 7300 7347 7460 7553 7587 7606 7624 7632 7641 7666 7670 7674 7677 7680 7802 7987 8215 8735 9086 9115 9128 9141 9146 9166 9185 9206 9265 9282 9296 9318 9363 9389 9430 9508 9626 9740 9794 9823 9855 9894 9900 9933 10056 10063 10067 10075 10099 10181 10187 10194 10206 10220 10229 10262 10281 10293 10403 10465 10484 10603 10654 10706 10718 10737 10789 10993 11201 11392 11452 11501 11767 12225 12890 13312 13634 14059 14191 14223 14235 14413 14610 14771 14905 14925 14958 14972 15041 15154 15326 15461 15481 15593 15685 15708 15731 15790 15805 15826 15841 15862 15882 15907 15921 15945 15957 15975 16185 16435 16456 16472 16525 16593 16666 16703 16729 16805 17300 17326 17348 17455 17562 17763 17836 17920 18020 18515 18753 18904 18938 19073 19117 19256 19297 19342 19389 19633 19766 19828 19922 19927 19961 19995 20010 20038 20071 20078 20103 20121 20147 20154 20169 20184 20204 20244 20261 20281 20302 20324 20339 20359 20381 20396 20409 20423 20435 20447 20461 20484 20507 20525 20568 20619 20656 20841 20904 20940 20989 21080 21210 21263 21523 21570 21931 22081 22250 22390 22510 22642 22682 22729 22739 22747 22757 22765 22776 22787 22801 22826 22867 22900 22933 22968 23022 23047 23066 23088 23093 23099 23128 23145 23172 23190 23211 23233 23252 23262 23292 23318 23345 23394 23422 23449 23502 23512 23522 23528 23538 23547 23567 23571 23576 23582 23586 23621 23630 23661 23678 23705 23726 23746 23765 23791 23804 23812 23828 23859 23890 23911 23937 23950 23958 23969 23975 23999 24009 24021 24039 24050 24070 24086 24112 24134 24150 24162 24182 24208 24214 24244 24258 24272 24295 24314 24333 24351 24369 24592 24898 25316 25517 25757 25941 26019 26074 26141 26181 26204 26238 26249 26257 26280 26283 26286 26292 26303 26315 26328 26358 26402 26415 26428 26465 26479 26490 26501 26512 26529 26540 26587 26610 26659 26900 26933 27188 27209 27242 27295 27321 27348 27504 27510 27553 27573 27592 27621 27628 27635 27642 27647 27696 27734 27768 27825 27853 27898 27915 28016 28021 28098 28112 28122 28146 28269 28350 28460 28488 28493 28509 28538 28546 28587 28594 28608 28621 28629 28648 28681 28701 28721 28937 28968 28973 28980 28987 28991 29005 29017 29032 29065 29078 29133 29191 29227 29245 29263 29281 29318 29324 29332 29336 29357 29374 29385 29407 29585 29629 30331 30355 30389 30408 30453 30460 30467 30471 30495 30506 30511 30574 30695 30818 30831 30965 30967 30969 30971 30981 30990 31003 31030 31034 31040 31045 31054 31059 31086 31088 31101 31113 31128 31156 31200 31247 31263 31285 31296 31329 31349 31398 31498 31500 31565 31614 31663 31767 31865 31906 31997 32004 32065 32129 32134 32140 32249 32308 32559 32700 32827 32895 32932 32939 32966 33012 33015 33036 33081 33132 33191 33260 33307 33412 33555 33580 33584 33618 33635 33659 33711 33762 33834 33900 33998 34015 34046 34082 34116 34140 34164 34197 34217 34227 34235 34243 34253 34264 34278 34304 34352 34375 34395 34436 34735 34738 34752 34764 34771 34790 34804 34811 34818 34827 34837 34854 34870 34918 34926 34934 34944 34955 34973 34990 35009 35029 35036 35053 35070 35077 35090 35125 35142 35161 35181 35191 35207 35220 35238 35258 35279 35289 35309 35329 35342 35361 35374 35398 35421 35434 35445 35450 35457 35475 35494 35513 35521 35540 35560 35585 35603 35610 35617 35630 35639 35660 35673 35681 35701 35729 35746 35752 35763 35794 35802 35815 35837 35859 35868 35889 35907 35914 35937 35956 35983 36001 36021 36034 36049 36070 36084 36091 36105 36120 36139 36684 36717 36745 36774 36782 36819 37131 37308 37385 37402 37420 37435 37457 37507 37517 37534 37556 37615 37773 37797 37927 37952 38078 38096 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.99.4. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.99.4 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.99.4 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.99.4 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.99.4. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.99.4Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.99.4Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5654 5681 6257 6617 7302 7363 7441 7536 7576 7598 7616 7622 7631 7657 7661 7665 7668 7671 7793 7978 8206 8735 9153 9182 9195 9208 9215 9235 9254 9277 9320 9340 9359 9382 9426 9455 9496 9562 9674 9788 9842 9871 9903 9942 9948 9981 10059 10065 10069 10074 10115 10252 10262 10270 10289 10303 10312 10344 10385 10398 10523 10581 10600 10719 10775 10827 10838 10854 10893 11143 11315 11487 11542 11577 11826 12229 12527 12794 13155 13335 13654 13674 13687 13876 14020 14216 14350 14370 14403 14422 14523 14678 14866 15053 15073 15152 15250 15288 15311 15401 15422 15445 15464 15488 15518 15562 15595 15618 15630 15648 15916 16235 16266 16301 16365 16440 16510 16541 16571 16663 17154 17184 17201 17341 17482 17679 17798 17945 18112 18670 18966 19147 19192 19355 19409 19544 19580 19640 19690 19981 20090 20147 20244 20249 20284 20319 20334 20358 20391 20396 20421 20437 20460 20467 20484 20499 20518 20550 20554 20574 20592 20604 20617 20635 20659 20677 20696 20723 20750 20762 20783 20813 20843 20868 20901 20936 20974 21227 21296 21351 21412 21530 21689 21743 22004 22055 22431 22586 22730 22870 22978 23163 23193 23236 23246 23254 23264 23276 23297 23306 23312 23344 23384 23420 23458 23495 23543 23567 23579 23593 23601 23609 23636 23653 23682 23703 23726 23735 23754 23766 23810 23848 23875 23919 23947 23974 24027 24038 24049 24056 24066 24075 24109 24113 24118 24124 24128 24163 24173 24203 24226 24255 24277 24299 24321 24348 24360 24372 24391 24425 24458 24479 24503 24516 24528 24541 24547 24573 24583 24594 24618 24628 24648 24668 24685 24711 24735 24748 24768 24802 24809 24838 24861 24884 24900 24915 24930 24945 24959 25147 25452 25883 26074 26309 26497 26539 26589 26643 26691 26713 26754 26765 26773 26797 26801 26805 26814 26825 26836 26851 26882 26928 26941 26954 26984 26998 27010 27022 27034 27052 27075 27120 27143 27203 27455 27482 27744 27762 27789 27838 27868 27899 28031 28038 28087 28110 28134 28163 28171 28181 28189 28194 28247 28296 28336 28402 28435 28479 28502 28603 28608 28685 28699 28709 28733 28856 28937 29047 29075 29080 29096 29125 29133 29174 29182 29196 29209 29217 29236 29269 29289 29309 29525 29556 29576 29582 29589 29593 29608 29627 29653 29662 29674 29728 29786 29821 29840 29857 29869 29904 29910 29918 29922 29943 29960 29971 29996 30174 30228 30919 30938 30973 31003 31049 31055 31062 31066 31090 31106 31112 31187 31337 31456 31469 31537 31539 31541 31543 31553 31566 31583 31610 31614 31620 31625 31634 31639 31666 31668 31681 31693 31708 31736 31780 31827 31843 31865 31876 31909 31929 31978 32078 32080 32156 32211 32261 32360 32455 32503 32593 32600 32661 32725 32730 32736 32839 32891 33137 33298 33453 33524 33577 33584 33611 33661 33664 33685 33731 33786 33845 33914 33961 34066 34209 34234 34238 34272 34289 34327 34380 34420 34496 34561 34655 34676 34714 34754 34790 34814 34837 34876 34906 34913 34922 34930 34938 34952 34968 34996 35048 35065 35086 35130 35472 35476 35491 35502 35510 35529 35541 35548 35555 35564 35574 35591 35607 35661 35669 35677 35687 35698 35716 35733 35749 35767 35774 35792 35809 35816 35826 35857 35876 35895 35915 35925 35944 35957 35977 35997 36018 36028 36047 36066 36076 36093 36107 36130 36154 36167 36177 36182 36186 36204 36223 36242 36247 36266 36286 36311 36326 36330 36337 36347 36356 36377 36391 36399 36419 36445 36462 36470 36481 36512 36517 36530 36552 36567 36576 36597 36615 36624 36668 36692 36719 36734 36751 36765 36796 36820 36851 36858 36872 36887 36906 37451 37484 37512 37541 37549 37586 37898 38075 38152 38169 38187 38202 38224 38274 38284 38301 38323 38382 38540 38564 38694 38719 38845 38863 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.99.4. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.99.4 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.99.4 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.99.4 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.99.4 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.99.4 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.99.4Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupeMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5748 5780 6272 6561 7106 7152 7256 7342 7378 7393 7411 7419 7427 7454 7458 7462 7465 7468 7579 7764 7992 8468 8802 8831 8846 8861 8869 8883 8901 8922 8973 8989 8999 9019 9065 9095 9148 9205 9316 9437 9481 9514 9553 9587 9594 9627 9704 9710 9717 9724 9753 9865 9871 9882 9899 9916 9925 9954 9966 9976 10077 10139 10159 10279 10316 10372 10386 10407 10444 10654 10829 10978 11013 11065 11281 11594 12117 12478 12768 13161 13296 13309 13320 13466 13645 13776 13910 13930 13963 13982 14065 14180 14321 14446 14460 14568 14661 14690 14710 14786 14803 14821 14837 14856 14876 14893 14905 14931 14943 14961 15162 15401 15428 15445 15501 15563 15623 15654 15678 15737 16113 16143 16160 16268 16378 16518 16592 16668 16746 17238 17458 17569 17600 17727 17763 17891 17918 17958 18004 18220 18344 18412 18512 18517 18553 18589 18603 18626 18659 18663 18688 18707 18733 18738 18753 18768 18787 18812 18824 18846 18863 18876 18888 18906 18930 18945 18962 18975 18986 18997 19017 19046 19075 19099 19134 19169 19196 19383 19432 19464 19512 19609 19742 19788 19980 20010 20332 20461 20601 20741 20858 20993 21037 21080 21088 21098 21110 21122 21130 21141 21168 21202 21237 21268 21303 21339 21386 21406 21423 21441 21446 21453 21478 21494 21515 21532 21549 21567 21584 21597 21628 21653 21684 21715 21750 21777 21830 21840 21850 21856 21865 21873 21888 21892 21897 21903 21907 21942 21952 21981 21997 22023 22040 22059 22080 22096 22109 22114 22122 22137 22163 22182 22210 22228 22239 22245 22251 22272 22282 22293 22311 22333 22350 22363 22384 22404 22424 22435 22448 22470 22477 22502 22517 22537 22549 22566 22583 22603 22622 22799 23083 23393 23573 23784 23972 24038 24085 24140 24184 24204 24233 24245 24251 24267 24271 24275 24283 24293 24305 24320 24339 24375 24386 24397 24436 24448 24458 24468 24478 24494 24512 24561 24582 24627 24871 24897 25151 25166 25192 25249 25283 25318 25460 25477 25526 25547 25563 25592 25597 25602 25608 25613 25652 25687 25717 25772 25805 25851 25865 25944 25949 26003 26017 26027 26051 26137 26185 26291 26325 26332 26347 26374 26383 26422 26429 26451 26470 26486 26504 26536 26555 26572 26729 26760 26767 26776 26784 26791 26805 26823 26842 26852 26864 26905 26950 26979 27000 27023 27042 27080 27086 27094 27098 27119 27136 27145 27164 27310 27352 27862 27870 27894 27912 27956 27961 27966 27970 28001 28014 28023 28069 28195 28286 28298 28362 28364 28366 28368 28378 28392 28407 28434 28438 28444 28449 28458 28463 28490 28492 28507 28518 28533 28561 28605 28652 28668 28690 28701 28734 28754 28803 28903 28905 28973 29013 29058 29133 29199 29234 29315 29322 29383 29447 29454 29460 29559 29615 29891 30015 30126 30188 30226 30234 30256 30305 30308 30329 30374 30429 30488 30557 30604 30709 30852 30877 30881 30915 30931 30956 31004 31040 31101 31155 31236 31258 31297 31334 31366 31390 31417 31443 31457 31465 31475 31483 31497 31510 31522 31546 31587 31613 31630 31659 31983 31986 32000 32012 32018 32034 32046 32053 32060 32069 32079 32096 32112 32155 32163 32171 32181 32192 32210 32227 32240 32266 32273 32281 32298 32306 32323 32347 32366 32385 32404 32414 32425 32439 32457 32477 32497 32506 32529 32549 32560 32575 32587 32606 32625 32636 32646 32651 32657 32675 32694 32713 32720 32739 32759 32784 32801 32807 32815 32825 32837 32858 32874 32882 32902 32922 32944 32952 32963 32986 32993 33007 33029 33046 33055 33076 33094 33103 33134 33150 33177 33196 33216 33234 33255 33269 33289 33296 33315 33330 33349 33894 33927 33955 33984 33992 34029 34341 34518 34595 34612 34630 34645 34667 34717 34727 34744 34766 34825 34983 35007 35137 35162 35288 35306 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.99.4. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.99.4 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.99.4 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.99.4 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.99.4 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.99.4Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.99.4Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..