ELF(@4pI4 (@@]@(A\\@0 6QQ O@@@( @0 fH!@P@Q?P1Р -L)/](ԁ@emain() returneddg   ! X(@@T @@ 0/ii// P-HNx~ -LM@PL00S @0 K080 0 0 0 KK+K__,^P/00S 000/F -LMP^P @$K0s 9pP 0ooK0 0X@P  d( @  0R(0R iK?OoB>_edA-^\ `P/0 !`8 00 (  , !/,LP -L릂P|&)0 !!X0`T0P0H000, !  !3^D-^,LP -LM R0S,pP(`P6P +(KDK@T P}  ` P`0 00CS  0@!@a0C0DKyTDK@DKf@qTDKhOP KP }P PDK@oPjPpePP 1.  8'$ 0@ H[U-^-^@[>___-^jd^b-^ D0-L@BP0,,=P07 K0h /^-^"_-^ -t0L0: SYX 88S!~g0Y҉$ Kh 00 :@e@B -1@0LPS@"@H/ `1Sʀ0!` 0    !B? SCVo0 !! HK'DI'<F'8ˌ0A';F-,LP-^-^.^@B.^0 P000/$@$ 0 P0 00/dPd@0 R0 0/ BQ 0R@e -LM`0@S7pPpCP) >P' 9P P0000 8PKḧ́h"PX0p P0RKh@ @P8P0K(.^/.^6.^p@\=.^@e` @ @ -LMk[&PP  ?xdJ]!7GgRP  GzP0007107' 7@7+RJ7尔ᴤḄt e Ep`@& 6 0**C7(g χlN6 P P "0fv솟1$6@A @!! *!& 1 !&06#6$1@T60S 6 606fTDC 1Q @P *P&$1)0C$10!10C0 @P :i*$1*0C,$11,!P1c001 1 @P :5*$10C$1w 1 @P :$1|U*0C$1i0! 10C01 @ P:$14U*0C$1V0! 10C01 @ P:$1T*0C$1C0! 10C01 @ P:$1T*0C$100! 10C01 @ P}:$1*0C$11! 10C11 @ Pk:$1)0C$1 3#@PH#H#H#H#H#H#H#H#H$p㔓3唣ß ! J 0 pPHT!>0 0C>0 0C uHĢ: nH묒: gH딂: `Hptb: XH("P9 OH200 |240 PU]pQ!gI!Tp0 GlH$,2,B 40!0!>0>00!10B#6 !$1 03/0 03/03/ 03/,IIIt1t! p1p! l1l!!(p! 1",E (K0p00 : GC.^@4[@0 DSBOF@eᆳ(.^gAiP=.^?lq?8`?n.^` )i W.^@qDili0iihf|ff@ffff@fg@\qɂ__(ԁ`gdgĉ@@|@ -L M @0 PK -LTM P P 1 0(K00!14!S AT1S1S1S o@ lKTTU@@H0[X@[SOo80[@BS@T 0p08P 0p'Kl`K^ 0  p0 0 'K 0<SR0 00^Q0 0 :/P@`,0KVW U0pPY:pp.^U.^ -LMD0 0P(`p OV@@D WPD P 0#K 0쐟0?#KK@0 #K  P 0 0P!#KK *P0 0\PD0p K#K 0#Kp @0P` (K.^.^.^ -LM @`Pp1Y0hh$p0PfGpW* 0S2 00P(0P `V V*`%,0K# 80 P 80 P8S PP f/ $0P (Kf/ 0<0 06003/卻`P000 0` 0.^WEV/^/^ -` 0Lpd 0@h 0Pl0`S X+ P I/ 0V 048<S Q PU gP0 R P  0`PU0唀0堀` 04 8 <0ڪ0(RPҺX R  $  (*/ -LM`pP K@00 (0@ S<(0<0(P S2<0080< Q0 0000000 000剿Y b9KPP: 0E?oY20S X0 p0R0b,<A( Q 0 KP!0 0 Rc ` 0S p W ,0SP[KPP `0` ` X0 D 0`"/KK1P!0100KwPv[6[W0S0S d R0 < P1 K0100K~KPP[Z >[  0K KKp `0K KK,@PY0(K!CW/^``0$ 6/T0$ 0P5/?>`P$ 5/0$ 0P5/ 0$ `8#8Kh/@e` " -lL:PX6U@ 0$ ``6/T$ `0Kh/"/ -0 PLT@``0 6/``0 6/`0 Kh/ 0-LP@@0 T000S 0d00h00p0x0l0x0K0h S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` @e(,@ -LM0PST@Be Sa  (0K0 p0*b7/pP  (@`0( `` 6/``< (6/``0 (6/``0 (6/``0 (6/``0 (6/``0 (6/``0 (6/0``S0  0 (6/``0 (6/ ``x0(6/``(0 6/``L0 (6/000S00(0 00$0 K@/^/^܀ -`0 PLT@ 003/V V ,|  00 3/0^- -LM00  K\ `P/0 !`8 00 (  , !/,LP 0!< 0`4 0 (   !/,LP -0LPT@ pX` X0S 00$ 3/@08`P#8$ 5/$Kk.0^ -0pL`T@ PW W x00 3/`0V00 V0`` 6/$KkV`p00 7/V0^| 0o/8g/ p-L M0@K`0$ PP 0 ZKpX1@ 0-0L@TK0hz$0dP 5/0 dP5/0(0%0 K0h 8g[0^ p-L MPW@X1PP HnD1D0: S#0!01  00 !0,0 5 W0 !00V0$  ( 4000 `0@ 6/0P Kph   A4 00  f/0$ ,0 0( 000` dPL{08 8Kph8g.^@eЏpA0^4@0^0^`1@\ `P/0 !`8 00 (  , !/,LP 0!< 0`4 0 (   !/,LP 0-L@+0 -1LP@`TKh0 dp7/U  ~U ~U% U U ~U 0 dP5/~ぁ0dP 5/0 4P5/ Kh|~8g[0^ 0-0L@TxxP0PP0 4P5/ 0 4P5/PN~ L~J~8g([0^ -LM1p@TK:0` dP5/0 dP5/P $~"~*~0P ,P 4p 40K1dp 7/0 4p7/ 0 4p7/ 0 4p7/(0KPU }}}0 dP5/$0 @?L$ 8g0^5[ -1Lp@T<P0` dP5/0 dP5/ }}}㭀0dP 5/0 4P5/ 㜀0 4P5/ 0 4P5/P}8gG[0^ -L M01@P@p(|,|0|4|00 ,&}(#}0 }4}f}d} l} [`0! [} T(W} P(]} L`VP0V} J} (| ,|0|04|(Ko[C}8g0 S-L S S Kh KhM0^00@o/@e` -L Mw@PK -@2L`RpP0CRa*X2R 3C7CR0 0 $Kk2RT 3C7CR008#8S800 0} &y1414$00PL0$ 1 Q 00 15%1c$  \ 001X0$0 0%5$0 0hl60d007 101000lP008#8S308#8S0xP0 p%(P8p d<151`P5008#8Sw308#8SqSW HdHd 1^N_ '1^ p-LM@`HP@d \0\ ,K0,0 L0 P (0 D0$0 08 8aP(Kp\[\]Jd[LP?@t?@0^ -L 0-L@z00 0R/  i@e` \[l 0-@0 LR + R= RV !0 1dPa05/|1|!dP 5/h1dP`! 5/<dP H!5/{0d4! K0h/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f-/0/-/-/-/-/-/-/ -LPpN`Q@P N/A0 2/ p 00S 0@0 @0000@ -L$MP@`@08 K0 0  p7/0P *4 K * p7/0P 0 K "( p7/ Pp80@040 0000D1 R `, K  P k K,@0X@p0$0d0 ! S 01 0 0S0h006Qd  s|0000 100 0(0K00 8/,0$0(00\0` ,}D1^.^e1^1^1^ 00S p0S8Y0S3U _2x0: S1 偳4Sڀ KwGSW`@PU 4 94 h PZP P0S00S Y U  0m|0S4 Q  |`0SVP * Rd d I pFA 0 + 00 0C% R00V0S P 0 l(KoT` (K[@e:[ -LMpm`@ p1V4P N  BTp10: SRZ e0s(ttt@(1 s@1 sP0P0PP0 00@k0 @k0 @k0 @k|0( K(0 p0p 0 h0$@ P < D00KP2^.^P`@H`@@e,`@`@s@e` 2^!ƠC9 : \S0@-h0@1X040 4 004040C@P@CL00L000  -@ ML, x$0B 0N?KDc@2^@-0tt@T h# 000S (0S Q . 0S"Tg -P@L VPU`p,@0S* 0 QP WVQ00S  ;P d@\`PPw ```Tg 3^'3^E3^ -t0LP@T ` ` &0`0@P N @uTg 0-LM@K K$KPgP K0 K0 0-LM@K K$KPSP K0 K0 -p0LM 0 x0KR@P d` R CPK K,K.P  K0P 00bt 0-LM@K K$KPP K0 K0 -LM@K K$KP K K -PLP@`aVʀ 0! `! 0    !0 2/P 0!H `a0< 4  , !d>Tg,LP 0-T0LP@PQ0 P 0 3/M>0  0K0h/Tg -T0LP0S@@P  B  R `6/U000Tg -pL M`Pܠ܀}P@ P' P% PU PE`F@P P #P `PT00 R0SP0 0 @`P(K.^^l3^p3^/ -L M00\ @T   4/KTg00S/ R//Tg00S/ R//Tg -P`<@Lk/ ]e/080Kh/dg - 0L@ S(@0` !P0 R  P TP X00S0@@@P @00 , !Ȃ @0-L@p !P`0S"P ( R00 @T P # 0SHH@`A`0 !! R00 Ȃ(n@,n@ 0  )?)/ 0  )?)/^/ 0-L@q d*Q0P0C"q 8 q (q 0r3^}3^3^3^3^ 0-P,@L[0 K0h.^3^o@ 0-L M 0@ Pr4  ( 0 0  (  ,  04 K$0 ,00 *P04 KK04n@/0! / "// -L&3^ -L 3^ -LpQ`@.  P@x0 DDP `F``p|`@U:80^,0 (Z غ@[///1/8#81/1/ <  R/ R/ I M0s S40Ho//0H1S0// 3^Q0 Q Q // M^3^3^ _ 0-@0LP\3/.0`R0DK0h/ 0,,$$#  K0h/3^3^[3^3^ -LM@ 0 3/(K03/PkQ%0 3/0 P) `T;%.T !7/'!0A`YSt@{@z@{@{@{@{@{@{@{@{@{@{@{@{@{@{@u@{@{@{@{@{@{@{@{@{@{@{@{@{@{@{@lz@y@hv@{@z@{@{@ty@{@{@z@{@Hy@{@z@v@z@z@{@\y@{@x@y@y@y@{@{@{@{@{@{@v@0y@y@Dv@w@x@x@x@y@y@y@x@v@v@v@y@v@$y@v@ 0 l t  0 -l0LA `pmha,2 4Q0,2<0$!   <0$!V KhR/L-,刡0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ刡0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-刡0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ ! ($0(000(/ ! ($0(000(/< ! ($0(000(/ -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480 -LMp@TB 0@ T T0 T9 !TX`` P0 S =S J Û@P0=S PX ꌝ@ĝ@؝@@@@X 0  SR0U=S@&@ w@@P(K i  ᥷P @K#@ KLLP@ 0-LM0K P@ 0 P RPC @K0 -L M@0K sP p SoK0-2P? @P4@54?3P0/x-2`? @A@P(PP`5P6(5?3`x/x-2`? X@A@(0000Kp_KP MKPH0 b/K1 (01 0 P>_/K G8H41$!0R$04$0/PO- R\bY I* b$\" in_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 // p-L M`P@ P@Q0P0sJX03/03/0?00?Kp 0K P 0S 00S0@ S0@P`gdg 0-AL0S! 0S\X l\,0_03/UA 00<000S: #: " ! 3\ #30 00C 30%V:P#:P!U P\ #30 00C 300000C0$000BBdgAi!i8^1?/ //?0 0!0S 0@o/ᐈ//0/////?  22//-P/6ᨉ N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: N1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N// 0-$0L@4s 0S 4  00 000!! 0(0000(0 ! 0(000000(0 ! 0(0000(0 ! l0(00(0\ ! D0(0!0(0, ! 0(00(00(0 0-H0L0S0@0  "!$0p03/0 !!0 hdg03 / 00-@L4 H< 4 @ 8 L < @  < 0/ 0-P@4 L040<080@0<0L00" @0200< @  000/ 0L 0 00/1 41H00 001/0</ -0` @ P  L       $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@04Yp<0002X10700 0\1 -LML1H -KA04pHL2 P2 P凢!@`!.K=L2` K⢷H2mK01, K1 17801"H" L" | _@H"eK!.KH @H2S M|0000p 0 00 `L<`r0@0@2S101(K@00S/ -LP@`4q& @00S80            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  X5 ?101101 ?0\!  -6LM SSpP`400 46CS(Kt K┶00 0 0 0 L0 K0C0C0 ` Jy!` ``@0@20 $Z@@ Kζ0K!J!<@PK41uZ 0  .@P @0K 3040 0 @ K0 4/0Z@42t T  tL0 0C0CL00" 00 0 -@0La0 , !0  P80T V0,H1  }/ 4102$Kk/L00CP002/@ 0 " UT@-SP+!6  \' PjV@0 L00L0A>@C`p`C\C  P1  0L000L0 A@P@ApP  0-LxM P  p Q `` QQSL0t KA喵0 K0 | x0 lP RxK0 0! R!10/Ph -LP` @`0 S   0  0-P@L!0S<00 00`(P$@@ @ 0,!605 000`(P$@ @ @Б 0!5,05 000`(P$@ @ @ὑ0 ,00!t50l5$ 0000`0(P @ @ᦑ 0!$505 000`,(P$@ @ @ᒑ0,04 00'!404 000`(P$@ @z40`,(P$@ @P1 0x40 <@0@0 @e 0!@4@ 00 000`,(P$@@ @P0 0 0!3 0000`0,(P$@@ @;0 0 0!3 0000`0,(P$@@ @&0$0 0 0 0!@3 000`,(P@ @0$0$0 0 0!2 000`,(P@ @40 0 0!2$0 00`,(P@ @<0 0 0!H2$0 00`,(P@ @ΐD0 0 0!1 0000`0,(P$@@ @ṐH0 0 0!1 0000`0,(P$@@ @ᤐL0 0 0!\1 0000`0,(P$@@ @Ꮠ 0 00!1'000 00`,(P$@@ @x 0P!00`,00(P0$@ @ @0 b(K_{^@8^ @8^P8^|@8^ h@9^ 9^9^h9^-9^:9^B9^J9^Q9^Y9^f9^u9^9^9^ -pLMP`K` @ ,0Kd #\0 0p 0`@R0  0 0p  00 0 0ˈ?oP20S R R (K hdg@ -L|M@KP`p` ᳲP0T v0D 0 0@ 000000ᖈ K謉 -LxM0`T@pT 0S PK` ሲT@ L0D 0 0P 00000 0l$K-h -L|MPp`V- @K` ^\ 0L 0 0@ 00000 0?(KH[ 00-p @lLBQQ0PS0Wp!80 0 @`FV@D P0T* Y*pCWp! BW0p!0 0 A3A3C?o20 0@`FI0V@D P0T* Y*pCWp! BW0p!08 0 0@`FI(K:^dg[9:^d:^ -@`L,PK M@%0P p T](K0 0S@ ` pb00 0 0 -LM>8  0N@T`p3:Tx3v# 0府ppPpW 0 寜PL 0p0#1@0 80X1(KP00C<0 <0 00S ` p@0T0;00 K0 40 04P 00S!>\0> ZJDP P 0S 0 غ[:^ 0-P. N@LE$0v0 K0h*[غ0@-ASp`T @TP0 0 0@$ -LM`P0hpU(K @Jd10K0 KNU@110[0  00P`PE -LM`0(0,000pS@ 3:RH0DP DP0P80000P0(`Pp0K0 -L M@( ,  (0Q P080?oU20S R(0(000x1D00(K`V P0A#AR K44 Q Q Q70S 0H0H0 0 BHP0` B0 00 HP0`>0 BB6*100 "*V00zbWp4 00 04 0 0 y P`F$0D0 004 0 -LM@Pp00 0(,8`00SP (K?oV20S 100V100 0!0`Fp0P(00000 -L$M Sp`00S:4K 0 P(4@ᓼ:0 P@ Z 0@@ <0 8 僼ʅ\8<0 P%d.ʌ P @R N(K 0 -LM@`T4@  0S  0000  0 0 00000 0xP P@0S(KP pXfTfA-P`@PpU\\0.b Q   \ *8  00GS0!>000P-// -LM)0pS@P`  ( "%+PPV@P@VP @K*0 VPV0P0" 00"%X( +0"%VPVP PT[:^:^ ;^ -LMPlA2/ R?0r? 0AQ,CQ B& R  C4 0 >0?`0?0?0? 0?p01?0/0//0 00x0 0000  000L0  8Khhhiiihh7;^C;^O;^\;^;^;^ -LMpPQ`U KP0 02@Ÿ0 *R"@  t"K>L1SP 0SKD> Ci (K  KK  KKT:T\1YT\\1\1@\1  1!0S 1*B0S 1VPUx1 R0S XP1 R0S  0T| 0AD@T& ! !r0@ Tm0 KKKQLG\1  GH;^0^T[^;^^ '_#<^,<^}<^<^<^<^<^.^AXVg$h,^<^,[ <^^0<^><^K<^X<^d<^q<^<^=^ -LMp`PP03/xB0\L3/0T1`2PXHq0 08@?42 0z022 00+2 00$1 001 001 001 001 00t1 00\1 00D1 00,1 001 000 000 000 000 000  00s$Kkd`$Kkhdg>=^K=^X=^g=^=^=^=^=^>^#>^7>^K>^a>^w>^>^>^>^>^>^>^>^ P-`@ P4 p!apЗ!$ 4 R LKpL Ae" 4/!\@P!W d dP! !oDЍgReset vector called, LR = 0x%08x-DMO-pB P!W d dP! !oDЍN  0O   ! "`"Рo41D00 :S L0L - 0S0 `201:+*B*R8 ?+> Q R3 < SPP 0  0P0 0(l1S#Z07?0S00&R ! R &R ! R QP1UPPP0 (0܍0P(0S 4 R Z 0(0L0(K0 0t K0 x 0 S S S 0 0 4QxpP_P0 40 p 00 0儀 0 [ 00 00 0dg[G^`gغH^MH^lH^ -LM`1 @PMpQpWH1  00S  !WL@倁$ 0 0t K00 00 0 K0 @ @ Q0 A 1@T=L@0* R8 6 @0TT00S 41~pD 0 P 0 $pP t Kܥ0 W0 04qxPp0 0 4I 00 0-(K`glH^ -LMX1XQ8 d0@3/`q@@aW<8ʀ 0! `! 0   , !Z Z& Z.0Ky00P0S00[0 0!!`q0   , !(K0Ko00P0S3[00Kv00P0S000 dg,LP[H^ N40-SL@00M03/000dg(0P$0141D00Co/ȉ!:!P/ 000 S/@0. T4S/Q0 /0ȉ.O. - L  - LT -0-  @SḠ((K `" pU 00W00S` 4 )1 4 L 40 40j@Tȉdgi -@ `PpLVQ 0 "PP 0`@R  UPp`U 01P41D0+' 0-0L@ C(0"(  P R0 H4Ph$1P420P!%R @A800CS00 80K0hȉjl+' -LP`ᕲ@<l@[@[PP00D3/003/03/D0@$0 0idg -pLMP(Ko``` `XࠟPU Y@ Q0,03/0(Ko/Y@00=84 (0C84 0<40C<4 0`01 [& &Rndg -L$MP0 `00 0Vs  000 0p P0`*6080 8 0<0 1D0 <000040 00 0H0 I 00`0@0 9 S@ 1 @ 0@`0 0@0@ 0W1 00C0C1 0100010240S ` H0S 0 @Y 0< 81  D 4 0    @40S @(Kiȉ 0-L@|0T0HD 0S0\* 0SHK0h*<0Q<%   <% @@0T0 T 0! Tpz(Kȉn -@`L MP@  PP@<@  *600 Q000  p @ 2/0 2/03/  00 0;UV 0p<0(Koڗ\00  S  S@0H5 40 02 S0D5(Kȉdgi` 0-LM0@0PSK⏬PK00  0nP  40 U0*0ᥝ+@ -L M@`T:~00(Ko/$::6V0100 Kp$U?P唠P00S0בCǑdP @0  <@0 | 000@03/003/JPȉdgi -P@Lp`9H$$:$  R2(DF0@00W@V UPPP$, !R  # R$60 X 0S(H$H J$J@L ȉ0 0-@`$ 000L 00SpP@5S d0)H4$^ DP4L5LE000<50@@0>00' 7t <Lu8unt1q0p H4!*$01004P4 20040@,1 0$1@@0 @0@@s1 00 @@00 0 00@@0 @0@@Z+000@@0 @0@@L ! <0(Ko/ȉi'@(lK^K^K^K^dg7L^i(n`g@]L^T@o(dL^n@jL^l@sL^j( 0-Lϳ:4@ ųB @ a0@50踉i -L$M0(($1P`v@@u~(0@@n(0㓆"V8 :(K0 8PP0 0040K0009  Pp4pW U: 8`ᩦ80 |Z pjlغ{L^XfTfL^@0!S800 S(00 S0;0+  !/i -L0`S0@!* P Sl0P S\0HUP0SD?P($EOKhiL^L^ 0-@ !:L 0T$ TD0ȉ ->L0 M~0PP@ p00 xkR R R`T1ċkL1HUn`Z(K$1!k 1!k ZQ#00$ʠ @FVJ00 Q  04 P4  tx t0$Z RQ 2HXJ+JZJM^i[7M^SM^ 0-@!:L K0hȉ0 /ḉ 0-P@D0LM@ 0SK0     a급C-p0;S AP@ 0R0`VP B@`p WV*급-T0+RA 0S00CQ ^ 급  -AQ`++D%L 0L+;;0; `k` ;/0S0P`k `+ +++ 0++t+l+ h+ |Ud+ x`+, p\+$ X+0?00?踉i !i AP@ -`P0匀L0pB@N@N@TO0?0000?%:P,5%5?[JZJDꠉwM^ -LM@ᜀzT:00(Ko/$::6WhP!P1$e?``T*L0 HS @03/003/ Jdgȉ0H4 /ȉ0  ")//0 !Р!/0 ! !/ p-LMP-P$ OK,`។02 ~?2 02 0  \ 1 Q   ,0(&#(0 <@0?6/Kpx'HfP4002?0/S 0?0 S/Hf 0P/Hf 0-l0 0QPL0kP0 P8@ 0ASA0000x'P -LMH2HR<03/0 QP (B0S0"S  & P(Ko$@ឪPi 0Sf $Pu(KoXP>0p P?#Kl1l080 `a0SX=@1a<0 <0 C06SPp1D ` 080j:0800#K8/P#K 0#KJQ Q Q =Q Qx6p4hd`(Kdgx'PM^@KLM^M^M^}HfZN^<$_[9N^R^*N^.^ N^N^DN^ p-L MP `0R1=A=A>A>A $K @P$41$ D0 @|0d03/@`40P@0  $K@P <0$ 00400040Kp@dg/? ᶓ -p`LP&.᪓~~M0@:0@P 埓0U P00P00 G00 ?00 ?007U atdV x0t4wF7q0H!0H!0 (KgA [,[ -H1P`L l0Rd PPDVP@@HHpHV4 !6@T $Kk.\[fO^lO^0^4^^_ -L M@ᣥ2PpW H1(KoT`D00LY uHKAJAtJAJAJA C"l3t$(0W?0,0U?000P3@>040K0h 0-LL1@0H3/PPP3P DpL1HP03/0P30P3P3;P3P^ -LMpPҢ`@ @Q 0pdL10H1 H1& H1  xcc嬂=⩂⦂x^PF , p`%Wpw eH1  zD5 @P0  PF>p0 00K,(P$  `k0P 0$(Kk?ap0 0K  \` `tp t#` 0QD!R ? `8$K$t K,D1 0 H16nQ  H1U ?0W P3<P3>0 P3@0P3P3  "> C F1h3? : S<?080l30p3: S0t3  2t3/.  Q)")0Cp3l!0#` KP3@ 0F?c F!l3 K000000t3S lpp#R 0XTl#0 P3 plc崡 0P 0H0K ` Ap00@0 0W܈K0H!`C V `ǟ @ +(((IF`,08(0<4 LH9/H4 # * R  #R K D Dr K<H! Xp@@0u[R^ -L(0M 0 0   K8_APcA -00ML06 0 0 K8_APcA 0-T(0P@P#0L8P3 @l3$0S$ K0h$ -LMp`ᰡP؟@՟ş 4%< ?\$ F V Z8P0@K0 KK00$K [ P-L@P00$001H1 0P$P p?`1H1 V`Khl05SZ4S*%SR$S* S\1l=Q{Py0Sv 030 30303:303:33030400,0? $0<4 ?"0202@120080$0<01L!H 2/1H1$ c-$ c  01*01`)S 0SS S*9S :`0CSS S3l0011~ 0!`y ,00*0020 00#0-000 0#4?`eR^S^@@ 0-x0(L@!60``P3P P K0h00$00K0h\k$ -`@Pp@0M 00L(Ϗ00 0K$ -@p F`0LM@PᴏP 弞P 6> C0 P3A> S9@A VT0`0 0 $K$ -Lp᨞@mH1PH1p4 P !S* Pd0P_PO;P0@ ~#P輻[AR/00S  0 r 0@o/// p-LdMH!P0`S }?!60#Q0`;?0@ ; S00,0,00ij2h0&hc40L10H3/H1 3 *0S` cmP3<P3 3P R00pK0op K4`H1lKp@@[CS^ 0-LP3@  L1H03/P3;P30 0-LPL1@0H3/P00J0 0-LםL1@0H3/P n6L1H03/0 -TLM V@0P `4 00 p咎P 4 RV 00ARM R 0 p 0`dR \RB TR(Ko+ ,@ X00X00P$H@ R H!!0S`x$80pp ,p"a "~T!P0H1A>(KoJ(Kot  ֶ Pg0 0 SO L  SȠ@*0S= 㺶<p0 N00000 00-0 :60l100\:60 0`oWP  `፶7hჶ(K 000041pD0000` 080,0441P0`ps9PptcQU`c 0 R0ZW` G F V` `$udndQvd8_At`A -LMPx0`pX@ T0P&60HP 0@ 00 00" K\$ 00 2022 00 000H00D000h0[ -L`@PbP0D0)2, 02<05 2/Kh 0,0 0  0,0/ 0A,00/ 0@00/ -LM<0`!P6)@p 0S   0 L 0 0S0L0 [(0K0 0X0'<0PX ` $Kқ   0  ox0S 3/( P 2  (0嶛0 W p@0 7/c 0"#0@ 0C S 0ڰ2@ 0eT^T^T^T^ 0-@PL2 h  0 -LDM@P(h080 0<0< p@0 0~ 0S 0 0   \0 80`p +48\0 0  K0؀cV^jV^\ `P/0 !`8 00 (  , !/,LP 0!< 0`4 0 (   !/,LP 0- 0L@0}0 帇@0X{A^ 00-L@0 08 00 0-@<LP080 x080<00 -L`ݗ@DPPp80S 0np0 0 QUᇅP <00QPQ<00P sP # -80L@SP <0Sl0#<<`V0L 0D8` <  @< 00S8PsV^ -P@Lh003/P` P P>Sh003/pIW Fh003/= -LPa5L@T 0  <,Ko) p| 0S0 00(0S     0R<0W:"0S0C0     S0!QW LL,P \0S 3/P 0\ 0000 0  0;; 00X0S000 1,\ , ` , @,0?P   0    JP P W 0Rv~( \ R( ,` (@` [V^ 0Qܻ耀 -@LPa 0B 0<@0 0Kh0`0S 3/z 0 Khh耀 -@LPh 0<X01X 0@1 00S` YKh10X0S1X  1@ 0 0 0< 0 0 01 R0S 0=@S4Kh -`QL@&0pSRvvP 0\ ; 0`0R`0,0`0\ 0 ?Q00100000C0, 0 HUKh -PL`pp0<00@ @ h0 03/<0@0 c -@`帀LZHDP608 R*L80S.d0S 3/# h80SF9LX 0LR@ 00  g~< #%0^0Ԡ

y0,! ,! ḢL!4 * #/X100T!\003/G#- c?0SR 0x 1001000 /@@@X^X^ -LM@pEponQ<05&:-0K/ K 0.0K{`.e,#VE -V@ Vc0/[1 " 0. [: 0h0-[ 0$3/V``P0W/H5 0Sh0 03/P65 h0 0 3/P0WP 0 (K -LMP`ڍ@<4`0000 0 000000000$0 000 8 P5/ P Kh5P04P800@PD00P0x2 \0p2x0FhP|@PP H t,Ld2p 00ᘘZ1 00⏘Q1 00F↘H1 00N}?1 00Vt6x1 00^k-X1 00fb$81 00nY1 00vP0 00~G 0 00>$0 0Pm0 $m0 Pt 00 0o{TKh{.^5Y^AXAZY^^cY^lY^vY^Y^Y^Y^Y^Y^Y^Y^A0^ A p-LMPd0`@ P0@@d0<0 0`40+P KphZKp]^AY^ -L M`Q00@A PF p㴡1K_ RAWI1 Q PRB RttPUPQPRPWX  <1Q PU(!8 1Q 1U!  0S  QV (KW p00 W00lt0WdUpP߽U,۽P pL`KO RU Y^^0^Y^^Y^Z^Z^_:LX0S @P@/Z -L`HP@0Lp0Y<0S8k P-$0 $03/03/$0 `kk x \t~oҖЖPU˖ Ö P -L▋ 0\ KhS -@t`L0 03/p PYW 0Khk꼻 0 -L  Q 0 03/0S -L$MPk@Pӿ K0`P0$0(0 `0 03/ 0 $0 0008i/  p 7/0P@4 K0pK 0 `p0*8/0P/0>088 8/0P,0 8!8/0P008j/  8/P $03/(<03/ 403/03/B@QZ^ 0-PL@ 0 $0 03/$03/(<03/40, 03/03/K0h!}P0@-h5h 0L0\ %%10B L0%)! %C1o< Q Q 0@! 0@`GMbC;yZ^ -L\M@X lKu 05K0lK$0 K6$ -`0L@$0 3/LPU 1SS p-L\M@P`X tKeu705KH0T@9C>H0tKX@ ,0 P $0T0  Kp -L\M@X lK@u_ 0-0L@S000P 0# K0h$ -LM 0Kà c  [ K -LM 0K!à c   K -LM 0Kà #   K -LM 0K!à #   K -LMP`@pW T 0 $K0 P`@D -LMP`@pW T 1@0 0$K0 P`@D -LM`p@PU T 3@0 0p$K 0 hPp@D -LM`p@!PU T !3@0 0K$K 0 CPp@D -LM 0K  c  o K 0-0P0@L* 0# K0h1 0-0P0@L 0# K0h -Lp̃0P(0S@@P jP`j `_?P 0S00(0 3/00000@00 -PL@0(0S`} 0R000 Q0 (03/0Kh -Li0(0Sx Kh% -P`LQ@T0 ,0Kh/0 3/@ -0PQL@0`  2/P E$ yP 0`( "4`#/ -LMp0$ @0 T ` K␠K ``0P*5/PPM0K0`8P0 5/PPQh1P0P0 5/PPA(Z `0 :/X Km0YKH0 00<0 $0Dp @p 0KT0 OPP$0 ,`V 0 006/ +nP PP $0 $03/ <03/ K403/(K rZ -LP@<@l`hQ -LXM@$0P`p% X |K|m< W80 006K0@ l@ P PP $0 $03/@ <03/ K403/U(K P r -L\M@X pK`k06K0VK4 8h0 00<0 P% Z PJ_oXRPU P娀X Kk 06K$0K08h0 V00<0 P d0 L (K  $ 6$6$2 2 ^^^^ - P40L S" 3/P@K000S@  3/@P`?04`V  H 6/P@2 2/0  3/a - LM T1堐@Y 0182 0P4` V 86/P 勴083/@1Sw  -L M0 4wi_@'0p1jaVjaV<\0I;P9 aR(K$WP JWPY >$ p ;X p @WP,W1 PQ-;U~opVjF!A]^V\` -LM`vha@|1U0x1_0t10h![?dx̪[?h!dR|v 100ⱁsv x100⨁jv X100!⟁ iv4j0 1! p1!1 @jV0p1$ E40 00\P U1 q0l!1D!? 0P4`6/0 4`P6/Y`  40P3/V n 0 !0 pP7/Iq `FpCh<C 0 ߢ7q`0  P  0`H0 0<` 40 0P0 0D0 0@0 aP 0 H0 0<` 40 0P0 0D0 p0@0 `Pl 0d `^(K Џd^0Ad^e^@>e^@Bde^AB^d^e^<Be^@e^e^@e^"f^B/G-MA 9090:0; 0808 Qar᠃0000LS \!0 1\Ѝ\00S @003@ @D 1(0=0@00/ -LL 0S 40 Kh/0S ߢ (f^ -0LL \ d Kh/\ 0â Mf^0/ - L@0`S P p 403/d V00Kh/0S Q嗢 sf^N  0O   ! "`"Рo0 `B@ P  B` 0ŒQΌ Q @倖0T00 P05/P  0 Kpk^ -0L@P Le00T0X 4`6/T0 d`X6/KhC8k^ -L,M8 dx0P d0 S S04 00 pؐؠd0S (KS CS4  C0 40KA(0@8`\R(0`03/Pc 0@@0 ` 01P  ap[k^dRBak^ 0-@$0L 03/$003/0$00) 3/ $003/$0 03/ x$0 03/\XP$003/P0}PU03/$0 0 N' -L0P`@ N0 0T @ ` BT0 0Kh/ 00-@L aN T 0 -0L@R0!d:/0( 0"( `0840 3/dP? 5/00` 40 3/``40 3/ 00Ņ0@D0ŅP0^p^^4^ p-LAM 0`QP @ @ 8@G/K< 0G/K5Kp螒^p^ -p`@LV@0s5 S2 r/ PPE_oRP! Q <P P Q <PP Q ;PP Q ;P Y U @`FPY P 9/P 0-@LR000K0h/ -X0L /(p^ -LQ<1 S  X!0C/7P7X<0YF*  ,0 3/P:8  ,0 3/P40SH S40080@S fS8000$0(0<00<0 _40 S? 0S   ,03/   ,03/   ,03/   ,0 3/ P  ,0 3/P   ,03/  ,0 3/P80S? S   ,03/   ,03/   ,03/   ,0 3/ Pe  ,0 3/PX   ,03/  ,0 3/P?0 010P0 P00 000,p7/ 0p00,8/0P0000} 0Sz 000,p7/ 0,,  P1+  + ^ 000,`6/P00 000,p7/ 0p00,8/ 000,p7/ 0p00,8/P"  1040 18 > P  0<0 0< R40S400  ,0   4 R; 3/40P0S1>   Z㰠  Z,0    M3/ P80S800  ,0   8 Rd 3/80P<0,0<0 4 R 3/  ,0 3/3/   ,03/ @  ,0 3/@0 Z 3/  ,0 3/3/   ,03/ @  ,0 3/@0 8 R 3/  ,0 3/3/   ,03/ @  ,0 3/@0 nr^ -LM " I}OK    0 3/ P~?K0>K0@`; 6/P 0 3/@$1  1 1 1 01 0@2 1!7Q01 wK23/P5 0 3/@0}K 3/(K ,03/P1 0 P ,0"3/1  CR ꌽBBBBBBBBBB4BTBTBB$B1~oK~K01 0 3/TV 2 S2`p02 2"S}?K0; 8/11 11 2B S1001 01 02 ,0 3/P (,0"3/P !,0 3/CP!,0 3/IP!,0 3/SP1!@001 OP!-0C?o2 2 ,03/!@ ,03/!` ,03/!d ,03/@<@2 1!001 P! ,03/!` ,03/!h ,03/! ,03/!p ,03/ "Fh`V0SpY2pW 2x$},0a"3/pP @&<`Q!,0 3/ 0 !RV wK23/P !q  ,03/@o!q?K  ,03/!  ,03/!  0,p7/2"4p! ,03/`q?K1 @;@2"SSgڂ1, K A T, K }?KT0`p; !8/T1001 01 202 r^ -@LIM.MK2 00 0K/0  $!(! 111 1014!(M/Kp0>   K4B -PLG@Oy  Q4R( RDy@G>y`t0S V 4y`0yV,yG(1$!%y0aVKO0SvG ,KoyxxyjG ` y0 S1BBB$B,B4BPBXB`BhBpBxBx  x@T`x\0Sx*G0 x0S Sxx 0SR0S dxpXX R^Q @x<x0 ,x0 x0 x0 x0 x0  x0@ x0 x0  }x0  xx0  sx0  |nxlxAudgxq R]xQ  AUx$ OxQ AGxQ Bxp,r^r^ s^6]^^^.^E]^40 0h000 0S(0(40,40p\4F>00 9/PC(4Y, 00 0p0 7/Pp@0\4D0`4Y0STv0h440L00; 9/PH10D100:0 0P0P  0  @00P000l081pP0<00 0=00 0?0&80 QPLvs0ڭ04(KXv(4h444l400.^DBxB4v^y^ z^BB \B.z^Bv^z^0S 00CS00//0S Rʬ  R 0%*0/ -LAJ(2`SP PPTQ $$O -@= LS0@  P``6/0 -=R B 0`6/-0 8R B `P#85/P 0 = S @ `PA05/0 {^ -@L$M`80 P *0 SP*0 SP*0 S 0K*0 0K*0P< U*0S X `08 0@0 < 0FS2(K0`p d0`h0Pl0Ut=S3: 8t #8:/= S< x 0`:/=p`=S00> 0| 6/P 0p4 8 `8 V< V V V Vt Vx V|@ X* $X S B= S3: 8t `#8:/= S< x `0 :/=p=ppS> 0| 9/~ 0-LM01 0 KP \0S  0S0?S00// -LCMPp_@U@$b 0p#PT  PP T0T=P 2S P0 # P t `ԢԒ0 z-=R0 ( 8/ P =' S  ` 08/= S  `P28/= S  `,28/= S` ( 98/`VS  ``06/= S  ``06/= S``  06/ 00`` 6/ha-=R0 ` 08/`V= S4 h ``06/= S: t ``b06/= S< x ``06/=KoK@=S0> 0| 08/0 SW0p J?KlUPO(KsTQ $T]>Cz ] {^{^#E\ -LP@i?`ps@ 0`$2  P H$Kks 0( 0=  R R " R pW-0R @ 9/AP rpP0}\= ?p \0S`0P s $Kk ីP M0(2 s.^B4v^DB,<^!{^0^ -@ p  L`APCQR U10 0 -L`@0p\:X qP PU0 Kh\ PU|^ -PLp1P^:p p \ ^0 $Kk  \*X|^/ -@`pP@0M 600L(g/ @  0~K' 0-PP0L @0@8O/0P l1  0K0h貁0' -Px0p 60hLM`X@0/0P l1 000@ 00 00́K' -p0 60LM@`P /|0T  Z 0P 0 0 z(K0 00 :/p'vd 0-@(,0L(!60.K0h̀' -`@Pp@0M 00L(.00 0K' -Php 0X0LM@H`.0P l1 00 0 K' -L(0M 0 0  # KBB -00ML06 0 0 KBB 0-L@= |1R00 0-@0(L@!60(([.$hK0h' -L@P`i=^ 0 Kh/ -LY= KhA p-L MP`N=AT 0` 4/@P nKpvd|^ -L 0-L1=@]$l1  0> =`Sh 04 / \ `P/0 !`8 00 (  , !/,LP -@`p}_L= 08/  t=S/PUm<= S8  `P#85/= S  `P05/= S  `P05/ 8 `P#85/_~^ 0-]Lp1-@P Xnm> S.<<_j=0=0>030 ~~^]~^ 0!< 0`4 0 (   !/,LP 0-t=L@S0T>P0C>=0CS=>3;3K0h ->L@S`p OPPVt=SP 0 >PS蠆 -LM@ !PpP` `(0KP "[R- 2[T  \l K0 B R  ,l 0 ~^~^ -@L M0K@#PPK 0-LMP@p=S 0 5 0000:S=000 KPx=[S Q  TD0 :S(C0C0C$C0C0C8C0C@CQ  Q K0  D -L4M0@pPQCCCCCt7S `7<`7=0=d= 3/x(K=hhX K0=0r XK# XK#0Z K|e5[!6&R!r7%[Hi1?001t7GS/( "0Cq ">0?0?`70?t7S 0   0 ot7S H/oh"vP K"0`P0[NK S 00 "0Cq "B^XCA -MLM`A^K PE@p0#EaP0U0C0S$4 K S;U$4 2Qu 5'0CQz  QJ  Q~ p=S#2Q #0CQ 0Q7-$0S$4 0?00P2Q& 0Qp=S; =8 0E sP#2Q >0CQp=/ !QS = N0 ?;A0CS PhTp 0"$4SS$t $$E /  ("( E YbN000$4 S = Np=S = N0p=S =N0 :S >S$f$4Sb* L  S 50C2#110L 1 0 $4 !H0Q 0QN0 N0N0-*  0-L@P T À :S :S 40  0 NK0hpBXC -p`@P㰠LM000 00U  )!00T(K0S # 40 8 h8  g40P|P00@@^ -@L`p=S릟pH4  3/>S.t]U= S`0d 2 :/> EP=0. :^^8X X3XR=3 \=3/p],KoQ -P0?L0M0p2K(0K `@KPU 0 KP0 P! -LM K l0 K -@L`0pPh=3/`7W) 5`729#9 Kh@ p-L Mx-0PR0CS@t 0@ӕn R 3 0HHf <@KphS @0.@ӕKp]]N^ -`=L@S 3/`pt]U': PP `V|i= Sd 2 ``06/= S``h 4 (06/ uP N[^ - SL(MP`p@7 >K >KDK] "0@ K.K -L@M3@@ > Dx=S S6P$)"" 8PP> 1PP@ dK^b0Kn U C& @PV0@0d KP3@ > U=;=$K)A S- 1R > P=x=  S :S PPn PP`0 S 3` Q (<S3 #|`h~0 PP` V@p ( !*(#X]$00- /h'/p-R/t-R/M -LdMS@\ 3` <3K+`0 Kf K`bV p %PUNK  wWP `pP? 3<3 -AMLMBnK `F0F@t$84 w^PP84VT$pAW7 +$ BWn  Wp=  W p=S fz#W(  W30 S  \ RP`p=S`  - U#WPQ )3W 0W\3WS=D p=Sq`F0@#S0N09 V# BS0N02  S0N0,  BS0N0&"W  W2P0 0G. P 0SPE 0  0 (K0 P P2W= 1W=1W= !S0N0  S0N0 V BS0N00 jP S :S x=S S S@!|0>031 F44 0JP 0 F0F0S2P 9S#PÚ 0P P P9S9  090 $PP ;p=S} > ;S0Tӥa|%F*-? -LlM@`p=S t=S?< hKx0 =t0 =S >S3;3(K9S7 YU 0S990090C9:0K 02K p 0 P <5 0 03/05K :S@.05K @ 6  xCPUG'W ?:S]P圦U VPU 0S000000C0劦&:0K (P (4 0 03/x}wpP'2 0 x告hxv x威PP^x5["05K *(0R  -   |0 p ˔ G|0  ᗐD :S㇍ P0S p P  0!:b(+010 0#4 001 0 $ 0#4 0h2008/>p0 p (00D100 0<00B$"C1 :_ KS* 101]0Kt 0>p0p(0."(0%lǁ#]i^ -LdMp=@S 1P 3@  = S4 h `P0<5/(K00 0|0 -=R0 ` 0P5/  -=R @ 0P5/<00l0K XP 0+re& -P R" 00D 3/=-0C==0=1 & n- R$ H 003/00Pd0K P, 0*5e=0.i3;3& E- R$ H 003/<0 0Pl0K PB 0) e=0.@3;3 -=R  0P5/`t0K `7[h)S  S = S>`P4 8h #85/> 3  =0S P{o0>|00S|0 &X 0>= S`P02 d 6[ :S;6[&[d[80 `8V :S0`e[PP) pW,0 ^Kp0< 0`ep(p3p20@@00x P$ d[gʄaI8e0[N8f0[O8+010 0#4 0010 0#4 06[ H80H847 0 $`06/0 *o00R0S  w!P 3 #*88S00C88WpHvltp0 0 0,LWTTaux 8 (P 0,ᗎc0[ Sx0 %Px`#xF&I)l`Q  p0xPE%>Yc0[`%c > -HX,%Pc >0= u0xPE%>>nc0[ S$V[ᨽP cX ` ` ` 8Kd[x `0S ``'c0[`PE%X\x0 P xI)Q 0,?1p0x`F&>Yc0[#{ct > -HX|#nc >0= "u0x`F&>>^[#Sm Su0 0l0K46[_0CSh$C|%C$C(%C%C|%C=0=:S :SY^ `H43/O=0=Kx=S >Sڰ"P? 0>< :S9=0; :`SH4 W[`PEUP#@~ U .>0/000000l0K6[` 06K&[0000x-W[p0 R RO RI2pL p0K >p`fP: l0K> G>W001>0#^Px 0 Y0 0x06[ 0fKE6[06[ZK`0&[LP0CX T05[,06[(03[$05[ S 0P0P xbqDp`,]^I]T]lǁ7]^^^^^^^1^E^k^.^y^ -LM@ppX\=3/PP0p= -^_ox=婒S 00S989=0= :S)C(C()Ch,C()C()Cp,C()Cx,CxPP ?> ?989x-R9 L;Sڦ_n> `L; 7("( L;x},1m 00 H:  )0% n  =  = =ۮ  =  ;S0ӥ= x4 :S x=S> P Dx=S ~G QW ;#| :S 3   q: ; 000======x=SY Sh3h3ݞ =>080 ح  KP& 0ga P$ca ! x=S ?7 1 &0 0C0S000ӕ ꤢ- R000 ` 3/-Zh1a0>9pk<0.R 3;@030 *:R132&s= S``2 d 06/X  :S xQ   :S P(K^  -%3]2D 1^ǀ^8 ^U]I -LP`:4P@pMT  @:1 00-@2Lp=PS0>S 0CS>02 xb]'K0h>S 0CS>x=S, 1>S02K0h]6^ -LMPp`+P@ Zf@P $K 2V0CVl*1Vv 1V< 9P-09 `94P@4P=Dp=SH 1VJ 17V1 @`0l`@P- w4P@&3@* x2(1V* 0V #' ᒙ@P#p= S :S    #-S@70.ڮ@ )4P@3@ x=S@2iii8i(7i -L,M@ LVPX < \,"\ *nb=p S2 d `P05/= S4 h `P85/0t=P0t=n_m0 P pPX[  :<K\0`,K0(0@ K @` <` J*;\xm4[gQ RB0\0x=x=S4[S:&\0x=x=S 0@0 <0 0@ KD0 0!d3[[p ##[0|=0`D0 @ K0L@` <` d 3[[(!##[0x-=R1  'SS, 08 KD0 08` 4` 0` P 80[@S60[.S30[-S00[S05 [x=70[0B00C)*d 40[00Cⓩ)20[0C⒑#1 [0 B0=*x=S<& 8S4& 0[x=S |md2.d 0 [뀝d  P d P0 [)  q *+`5*,0T5`@0H5bD0@508504530::> 0 P ^:4K㠠H,0K10S S2 ?00;34 MᴠX0F KP4[,K SBQQr  `RQ"1?0;;S4 x=ڎS0 =  0F KeP4[ d00= -x-R, R RA -#Qb?Ӕ= ڨ#Qژ0=3*Q8<: :<:> 'hZX 0X=_ `@Z0/-,-Rj>0=3R:8<: :<:>  :<(0F KP4[S:0: 08 K@0 @0KPn@0Skڸ[y6KY ~X2 =P2=徐ᇍ>Ⱀ PPU48H4"d=T4h=1H41 ;1$;1T410=14=18=1<=6@`1X 0>8/a= 1`D8b= 0`8lZ5 (K2R:;:yH0-=(1R: <:>Q P]Q K]JC3^]|^ ^x]^^' v'N$%^,^|^Á^ց^^C0C/C(CC^^F?_eQ^^u'(O * + (B/CLCBhB CBB@BClǁ0N1^I^ -l=L@S% `tmP pnF2ᐕ"\"cb``rW ᜜ER_X X}_ 0-@LO(TM0-0 -p=L@S*(P 3@ -0`P-R2 d 5/= S`P04 h 5/R2 d 05/-=R0P0 ` 5/P = S``02 d 6/X 44S //0p#R" /84S// -L MP0Bbj?0᳐(0 :/43\"0:/(0 :/06. 0\0#0:/\0 #:/)4#\:/(0 8/43"\08/0/08#80 R0003(K -BRL`p,0 3/,0 3/,0 3/,0 3/ -L MPr2,43/p20p2坘nPx%: 0@00 Q00W2>Pp媙3<3 -LMpPBb?sp?pp (09/43"0\9/ 0(8/63\p(#H07/\p0#7/\p0#7/53\p # 07/0\p$#7/03S \p0#7/6\p0"7/\p0"7/?<0 \p0"7/\p0,#7/\p0 #7/pp(0 8/43"A0\8/p(p0 7/p<1\ 00!0"p8/Wp4K %1>80 80 \p8  o !x夊ᢊ0XK@=00 K<P1\ h00 P0 0040 0P )P P (P P06P0 0p1i0H10L10T1؃ῄ60000 00101f `0 ℆`P0 0 3/`PJ 0@G0SDAw% ^p](+ -P0L#0?$1@SP 1S nU1 10  101011 101`% -LM$1@S P 1pSX 010P耔(080 000 3 40 BR0000 S <2"0  `@`00PS40 0PEX. P^ᅉ00`H`V!:1 1`d01 10 11S !0C  !S 1ԕ 0 1ĕ\` 16/1 101ᜉ1S RaQ叉1P 0003/1 01 010,03/1SJ 010  $0 0x0A!0,0(Ko/00P`FSPV   0000 S <0 0   803/p10101f0 P`R4  PE^`(K萕lC -LM$1@S(KP  ш`0 d,P5/1P SPV`0 d,`6/` 1 \Pd5/`0 d,P5/P1 S`0S]`0 d,`6/` \`0 d6/` 1 \`0d6/`1x \`d6/`1| \`d6/` 1 \`d6/`0\` d6/e`0 d,p7/ `V`0 d,p`7/`0p, d8/ 08H`0\` d6/`0 d,`6/0p줟耔00 ` d,03/` 0S  "QP$l0p00 Q04S0l0 l01S`` 14T PU`0p d,P5/`0 d,P5/P0S`0 d,P5/  1S 0 1/P`U 0t dUP!Pl`06/00C00PP`0 d,P5/P PUTH  1\` d06/`1x \`d6/`1| \`d6/` 1 \`d6/\`p d,03/`0S  "QP l0p 00++\04S l000pHSp0l0` d,03/` Xp耄10110X*101X1011S 0CS 10 10` 1 1\P d5/`0 d,P5/QT1`P%P  8>40 40n 1 1PQ 1000001 1 1 d0 1\P 15/1S01010'^Tg(^p] 0-L@4K0h -L`p@Z$!0S !t@S0C0i0@ ,P5/Y0 ,P5/0P,$ 9/t00S "SRP0l p  ! P$Rl  l /萕(Tg ( -LMP0@`0 p0 7/pP pU0\H 9/ `0v UO`8 #88/ 0\8 9/0\< 8/U0\P( ) \0( 8/UP\PC0< 5/0\P4 5//0\P, 5/0\P< 5/ V00H \P5/0\P 5/,\0ES8 08/0\0 8/8 \08/0 \8/F40\ 8/U\` @06/$K -`pLMh@P\ \P0 CP 404 l )()`dp\`hP $K(Tg.^ -@0P`L M|&0K%PKE p& K`% KX4` 0I ⤅01@0` 1 1\P d5/V`P%0[ h Q S'  S  \ `60S h0\0P lC1 0CSh L储&0[S0@0000010CSfꈚCC@00 dD9/pGWH $1C$Qp -LMP\ p@0 h0 `@ 7S 3T00R& S $1@ 00DD9/0P@T 00@0 9/0P@T 0 ,@ 4/(KS @$10D0R' S#PTpE0 0 8/ 4K0@D@0 4D:/ 0 0K pGWH $1C$QpS#PTpE0 0 8/ 4K0@D@0 4D:/ 0 0K pGWH $1C$Qp \ -P`h0L7)||03/<08 @@@R4S00@ T`  h{? T? @?<?p +40\P85/TH^h^q^.^ -L M0`4 00 \000`hp@PtP`3  00 P  ,0,3/, ,03/* ,03/ ,03/ ,03/ "" 0" ,0 3/ "" 0" ,0$3/3-n 00p 34 8\ 0 0:/0 ,:/2 0,:/ " " 0"0 ,:/00" 0"0 ,` 6/"t00p  34 8\`  0 06/-00-03 034s`3 00p +40\@84/ V 4(Korp,d 0"(K R-L R R3;33R 03 Khs 3 ;3 f;<z^^\ `P/0 !`8 00 (  , !/,LP 0!< 0`4 0 (   !/,LP -L M\0`Pph0Q00 `@0 t0S 3/ \0$:/ 㒠p +40\8:/}㇠0 ,`6/p +4 0\`86/ v00S x0S 3/ (Ko(K -LM@x`"kyPqsP#pdyP!$ 0 = 00 :|0x @ 0 0 0h0 03/$Kkc  0 $ =ˆ^ш^^^^PC܈^(0,0000/ \ 0-0@LFsh0 p-@LBMC^KM PE` /KKly40T@KC S c @KvyKp$C0 RD   R8  | R, |  R  X R X p̰CC$C[пC 0-L@0\0 !@Q0@000 -Lp@P0S 0S 0a@P gPp@ 0-LP@HqK0h -0L`@hPtP 0 \00,,@ 4/xP 0 0 0 0h0 03/P 00 0 0-P@LQy0,K0hr -LM@P1Tp #3 #300 0 2y00S 0 S0 (Ko0 `P`(K @L` X 0 P  0 @00T@꼻Mb^ -LM@lhpPUp`PPo(K\0u"Pxp,4,$0 $4!YT:@<0 R80S@p<0$RtxО80S0s0Sx<00  x<0S( 0/KuP x0L#!ux 0</KmuP x<00 Rp  P  x`80S<0Qt0S 3/0\p $7/ y ,0,3/p<00St0S 3/0\ $8/ _ ,0,3/<0 R@ 8 Rk4Sh@f0!tWt0S 3/_020\ $8/ 2X0\ 8/0\ 8/ ,03/XP<0p00 ,03/P@ #>K00p<0pm \0(0K0`0p  80 SU<0Q 1!0 꼻 Mb^^' -LM@\ pPh088!, <08 RR<@<0 #`30@`S00w 0 _ 8080$2\ 0 p*Y 0~w(K/ Y40*p x0S 3/#00 3<<0p 7/3@0300 #,##*0 #Nwr##  <0  `P((T P%(hP% p(x( (P% (ȜP%( ``&( `&`&( pp'( p' p'$(, , (̞ 0  .0`0 P 00ĕ  ̠ Ƞ Ġ 00  0 p 0Ě  ̠ Ƞ Ġ 00 0 0Ę  ̠ Ƞ Ġ 0 0( 0 !,$ 00$(  "" " " 8Ѝ]?]-0 SR0 ,@SR,@SR,@SRS,@0 @0 R03S0x0#00/ -L$MPPp@$ Q!@  TRT``S@a   DKWP DKRL DK M KA0  CR-LQ0  ' -oPpLMP`@s Rp VSS00CSgCCC@CrPV(K0 L `@ PrT <KZ0< KL ` @P V  <KI<0K L x <K@Y`@2@0 @0T  0<0K L _<0[!0 03"10  #P C 0 S2 0Y00@` -`oPL$MQ@@0 P0S @0RS#C2D0 0S S& pD0P T@0 pb<K<0Kg mL 0< KD0(K0 L@p D0P05/cv^ l0ho00`0S PZ 0 p200p W` 0S2001n8^0 Sd0001c00fF8*h0S00d0Q00@Sg/1!t11+7L`01 RA 1ES  s00aR310@0p11S01(K16 "6&0- R    R    R   "-" R   .R 0  S0@00p8Sph0 S,&01 lǁ^U]ЕԕD͋^0.R  "-" R   vP/P/////-RDPD|DDDPDD0\ 4^  8P p7S0SU] -L Mp@崠`v>0S4 0!=(P㌀1Sʀ6(@T`(K01 00 P 00< 400U (P^ؕߋ^0^.^^܋^ -L`@PP8!8Kh10000x7vnS00tq 20zt7S S S0< 00CSDDDDD Dt7Sh8D!0 0<00;0800808070B;0;V]^ -LLMpP0`p0 s@0 p!M@  v dKhP v>0S71 3a0 vh7  0 vh7  0  uh7  0 uh7 0 uW 4P4t8St7tX4S d0tg6 V rM_N4 R`78`7`78V]^J0000 000/ -LMh1P c1 R S00*0 0S0:1D!0CR @0@0D10D1! !0 0 0 000 R000 0Kn\0D1S 0S00 000 S D10CD1! !0( 0 0e 0  /^_^΀\Q:  / AA//// p-L$M@8PQ"1 00#!" 0 0000) `0V :3/P 1 0t | 10 18003/@ H08003/0<0000Kp菌^V]^͌^X] -@pt0t`L:l0^`婎8`9/0<pp0@PU,0:(0:$0: 0::X]LDDDD0S 00!, QQ !/V]^#^0S <<!8 \ \ R !!/W]^#^P0// -QLM@p`P ڐ1 0|"| $10$1 (K\XQ1I(10(1,"1h1 0O d n/X  h7岐`71 0!Q `W h71 !D `80S0S% `03/P1 0,!D. 벐,10,1W1 1 1h000 8003/8< 0`R*.0K0 K9/P 120!S 0! 0`  W㲐`0`4!S 4!q 0$ P k3[02[0e3W]W^V]n^Í^^0^U-^^P^^ 0-@PL:3/P:3/0 0-@L:3/yvsp:K0h/ -L,M8`@VPpX!1 ᴐᲠrj0 0#!"!0 03/P1 0 000000| 101(K \0R 1 < Dk 101 :(Ko/Ꮜ^^`W]^^ -LM@`` 1RPnP1U`S^1 j0 0tt1 7 000PK08 RDD  0 RppS`7p0pp 3SH0L RP00H0 00@Q&@0 00T 0(0 0(00S*}@P  C# 0 3/P $K C@X]?^xW]W]n^ -LMPp(0`S@!R!  %0K }0 0R@%@[@N@80S*3PU@ 00 0$K (0  S*!R ( ($0 3/P@W]^X]/0-@S0, -L MPY 40 0`  @00 pU40  0#$)< 0)8 0)4 0*4 00 p000800;00000S/ /00S0000000     00000 0(Ko00S0000000010 -LM<00 \||0c \@@S`7@ @@00 !# 3  4  4 "$ 0I Pp<\K@ 101(#|K LKIK<`0`@CY @I`00 T0F0 &ʔ0SPU6T  |K| KG4l KK~0K}pK lK \K|K| K ,(K |K| KG4l KK~0K}pK lK@DpT`@9 `0S 1 # R  B|K\ , |K| KG4l KK~0K}pK lK0S1#Y IlK R` 0@p0C0 ` @Dx 0  `0V0C0  P0@U0CW]n^ -LM0<S !"  8 4  K0  Sڏ^W]<V 0-@L{VP0@000W] -LMP<0  0 0 0@1 g 0 000(K`0840< t0K" SR : 0 0 N+0 00000 p` |K1010( 0 0@4c8<0l0K 0L0K00K0*K(\0K A9{ \K0P 夀 00 0@CZ @100 CX 9 0$` 00S0 CX F4| KK~0K}`K |K lKl K lK\K|Pe 0@1 0 g /0 000cI$~ KK 0 }K  lKl KH00X00 0@ Z 010#S@CT @0 0 00 oF$~ KK }`K\  d lKal KQ Y0`J000 00@Cg &zz*K"^a^*^////< 000/< 000/ 0-<@L1 P }f0 #30000蔐^ 0-<@LP1 ff%3 0000跐^, 40!44  /8X] -@`0#800pL40040040P 0縀P 0  04 0  04 0  04 0  04 `V㸀 -L M@P@0`0ᴠ00 帠ᶀẀpp  ("( 4  H$H@ 008#8000  x*Ḡ q(Ẁ jx'xp c4 00  " @H$H@ @$'@08#( '8 *807᪨ (8ᨈჇpx0'8xw0)400  000 (K0 $ / 04 8 / - L 0S<<I0 0S00R`'0008Z]n^ -LBMI_K \@ p`$K`@@a^ ` \qNPPN LaS10C^QS  $@K pAW$KXGAHqW@@$pK@ATp@$@@$@AB"$$P "(!K'K"",&K%!KJOK$ K !Q$Ka^aA!NQ $K !R "Q0S$K8X]ߐ^ -LAMPKoK \@ p@,K^  \qN`` @S 10C RQ S! p @'@AB,K,$,@KAXYHAIX@@,K@ATp'p` ,40,8,̠0 EP,0K1Q,KA\AA1LQ00,K01S0#U0(Kߐ^8X] -LM1K=K 0 00 S0P  L1 H! ,0KH!QL100,KQP U!A L Dd(0HL@@P0\! @D \PU*T+ p1  a0 A,KX,K YHIX,K^.ༀ.#4.0#ĠD1KCK#Ƞ#u;uP֑^ -LIM1K=K 0 00 S0P  L1 H! *,0KH!QL100,KQP U!A (@ B@DP0R !@D H! H!QPU*T+ p1  `0 A . ! ,K#4", K !XYH!IX ,K !R. 0#$D1KC!K#(#  00 00h0 Cp0l0  1S l0 0>0000h0 p0&p0(l0`' 0h0 Z `TDpSDSD`TDSDSD`TD 㐅 P 1 `K@^= =z000V dTuhi0 x0 P` !x0 `- P= U  h0SJ Q1S =^ 00 0h0S;h8 x0 0xP p0 4qP 1 `K]p0P4!LK]\<P \<xZIoᩒY   LP  &PPY t0000l0Gt7S0A00S00S !R 0t;000S)0 )!! H" !P\ P B^ʐ  00 0:*000101<0%h0S S SD`` d!0p 0d!p!5  0t:t*0:000&``0d` l0 0|0 i0pPuP 0d 0 06 d0`t7S0XDXDXDXDXDXD$YDX 1 9)09000l03  0   P1 (90l9000d`X0@0 `71 8(09z$00$0101Xh8U1 8p(08d0 001 00 0l0&l02S1 8'0@8Fa0 6/ 2" 0 S.0002021 LK\> 0pS.00C02021 LK\> 0PQ1Sz 3/w1 LKj\P1  HQ 0SH1L1 P10CP1QP1 S0 900S00000d K0Pp0 101< d0`0@000cd`00t0 0 !p0 궡0 x0 t0 00SJ Xsd T0倀0UX 0! Z  0 P0  ~P sx0S 101s0d0 1p(Oq(0 0(00嶡t0Sd  `t0S 4`0|0Vd` p0S 80 R ,0 dp3/P 1 ,4#0D4101ddd`0S*us`Pd`   LK0S^0S[0SX0SU0SRXOGoK0[ 0SpH SK SHK<K BK00 ,0K4#t0 (0x0 x0`S: s `Y (0 C8#<4 0#4 0Vd` 4 2y 04"S ! ( 0 `2("000101sGoHKk <K<Kf 4KZFnpPr0d0 |00@S" 1 1|!01W00000101Eo00x0 CfR  n0 H0\00Z000CC@00R 0 n0t0tp punpPr 0p0`'?o2<7 04 S1 (00(0101^n^^^^&_^Ғ^^^%^/^^@^^^O^[^g^^ē^^pG^^ ^?^U^r^^Q^^^@^^^^?^l^l0%l0`10`1( AAt7pS`7 Lu@P0<0%'2S30600I5 y#P 20 h8P@@`  @! !b%T (S 0R7@q000KST 'q`(V(K000S@0@@00@0S R 0"42^ 00 0 @W W`70 h2 LK'` Zt0 00;t7?o2S0@0 W 1 2"0'!2|40040`7 1 $3$#0,3k$00$0` K0:P~ `0 0@00`d0 0t0`0a06/`Yqh10h180080t7Sv00Sq2S1$ 4$0(4,D10D1q0 7/Z S d  0t$t4H10H1HqW 0SH1L100P10CP1!W'R LKjY  -L10L11S% 3/!PX R LKOY0 T09000000 0Spp0p 000R LK0Y q1S 3/1S h0 06 -L$M@`P @p@q 8X `0S1`g` @KX0 0H0 3@00@0 1`a 9(K耕^ 0-LM,0PS@G,,0S 18  (KX  ,K0@@^ -LM@S@`pP S S 1S p?/1000R S 0St7Sx7S^ 40040DS PS S`7t7S22S1 0J S21 ?/Gr0!?L00L0 SF Sx7S40040 00CS/ 1 D00D00J S*1 4>H.Gr0!0>L00L00Sr ,SN S@ k S< h ! 0 - =P00P0ZS\ SQo1 p=-Gr0!l=nL00L00S SD > *SQ0Q0K8 1 X0S㺟)  R75[?0Q 2  LP,8L0S ;!0:1`7 0 00XK00=$08V d7 Id78d70 00XK00&$5[   P! X KP 0P`00 0P  ^h8X`'1* 3/?S`X0K L HDtZ x7S 40040 0 QY-1 5%0 5~D00D0A\*1 \5p%0 X5jL00L0\ 01:2\  R 1 $4 NH00H0oS1 4$0 4=D00D0^p W 1 x$pl4 ,H00H0MW h R p0 Pp0 !  4 `00`03o`7r} 1 03#0 3`00`0h8V Z 0, p`V 1 XKUU 0 00 00- 1 p2"0 2W B  p0 Pp0  I`Q0P 5/1 HR  @2T"0, <2L00L0㸡qἑ lKUp 0tE:S 0 3/P1  <1!01~000t7S0Q8 5/`7 1A 00!081cl00l0t7SQ0 5/{ZS1` l000 X_^Q^<^2^$^^ ^M^f^v^^^^ʖ^^R^x^^^ԗ^^^=^O^\^^ u^0^^Ș^ؘ^^^^5^*^^(^^^q^h^@@^^c^^^ ^)^:^^B^^^͙^^%^H^^s^^^^Pޚ^P^1^^9^ 0 C ! 0 0000 0X0 H R! 0C0(!0p1000 tQp( 0  R GRZ 1 10|1!cSu ! 02! 0!1Qx7S ! 0\2JW W㐁C  p\2\":0 00h8V, `PP 2 020000P ,J1" XKS,#U0300 Q0 5/zR PPzh8V n 3#0L3f,Pf 3#0x3 'P  3#03h00h0R3 XKS( nx7S9W) W7,P B0,0Y 1d$  XKlS 0 h8V<10<1h00h0 1 3/ vP  ,Q0 5/1 pH5H%000Qx7S1 3/Z 0S! 0%5c000t7Sp xp0 yt7SꔀDDkDDkDkDDkDD! 0@&@6>x7WS 000h8V  `P 2 02Q05/1& XKR  0S 2 ⇼x7WSY 10' XKR 0 Ph8 V<10<1h00h013/_ 1 3/X1S 7'*d00d0t7SI0Q 8 5/At'Rx7S 400407 W0000 00St0 0 0IQ*1 h8T(Gr0!l8L00L0hP 1S 8(Gr0!8p00p0t0S" 00 0|0 p0 0 x0 "0 CR*1 L98)Gr0!P9L00L0 0R0 R Rx00x0  0 Sx0S!1 9)Gr0!9D00D02R  RPP|00|0 p x00S! \*0Grx:!vH00H0Z1 :*Gr0!:dD00D00 S! *0Gr:!RH00H0sS R9P 1 P;Gr `00`0\V1 PS  XKQt+;Q0  0 00t00t0>1p 0 1R0 `7 1 , XKvQ$  0 Q5/ 000 l h )&Kp  0Rp  !l 00Sm Q5/ 0000<, Z1,< p0p 0Y 1- = p0kK l0[P !P =-p p0 p 0 t Jx Gx(0Q'1 =hK0 0 00 0 0CS0 sgj0[Jqp 1D.p> 0x>  00 i0K0!pp$(B(8#8W'!k 0p>     Q Q0CS#bqg [p1D/I d?p!t= 0?L Z1/?2 /Cp0p 0Y 1/?# p0kKl0[P !@ 4;4+Op p0p 0 t Jx Gx(0Q'1 :hK0 \0 00 0 0CS0 sgj0[ Jqp 1X*`: 0X:  00 i0K0!pp$(B(8#8W'! 0p9   ĩ Q Q0CS#bqg [p 1X) l9`  Wf Kх!Ї$&K10) XKOp0)6[0Q0f0[0h0[ 0i0[0k0[0l0[080 ,P >0,001S XKOt0(Q0xx80  0 Q5/x00x0Q0 x{0/S00`'2 1S XKOt'7Q0 0 Q5/|00|0&00000?0?h80101h8M? M? h86161p0S l0p00h006[9||0S 4v202 F 0P e>p0004P ^>|040200LS1 |6|&Gr0!86L00L0꺁hhX 1 XKO$&0W 60 Ph8V<10<1h00h0  0\Q:1 5%Gr0!\5}D00D0LP*1 L5L%Gr0!5hL00L02P  P P0Z   P0S! $0Gr4!@H00H0a0ḡἑ 1 XKNH$0WD4T0 h8 V<10<1|00|013/=X㺯ᴒN  TPH20210v`7Q / ? 67Q`7 !6/0S`77!66`71 XKUN`@#@ß   3 ß "0W0 1 3/20276`70q00101 P400401 XKN0 PUt7S S 40040 1 3/h8V mx70CS4004000CS 1 x1x!0( 41uL00L00q00101 YP400401 XKM0 $ t7S S 40040q 1 3/jh8Vg !c0GS|t7S[H|D~DkDH|DkDkDp|DkDH|DH^^s^^^^ޚ^^ ^^=^^m^^0^ u^^P ^)^^J^^^^^^;^ -0-P@ LM0 K0  K@iM0K K0x^0000S0004 R0 000u/ -L M0@t7S2S K0K -L M`t7PS2Sg 0!1Rc (K0pS\:@(020100010020 0083/ ? 071 0=1GS00 4D1"022222220 " 8,%" ZN!282S887-7 0C2c70r0Q   0   04Q   0@@pCp K3254U] -P LL0R`@8pL yt'R#ݼ80(R#0 83/?G/@0? @D00Q0000L00 ⸼00 R  ⰼ001H0 -LM`qF帡_KT; 0 Yf 0( x2 )0 4RSK +x2 P8  R #R"K   3/?mK l2K? k2K71j2Kn1GS0c2Kc"[e0S/S1pCq(K KV0/K0R"[R 0Q   I0   0R"[R 4Q   ; qP0pG@U] p-LCM1`S@PKp IK?PP IK`P I?K0,ᦻ0Q  R ,!0IKR1ā!8P -2LPS@ 0aS 0 6/Kh% 0-0L@3A0ASe ٻx00 -LLMh8P @BRVhDDDDDDDDDDDDHDDDDDlD̠D@DDDDDDȟDПD D(DؠD0D8D`DxDDDDDHDܤDܤDܤDܤDܤDܤDDDDDDDDDDDDDDDDDDDDDDD`GE0 0; 1@(Kn0|7h7 n0@00 ! @   AR! !@T0009`75S S@ SA0100!e R #q@7`7#20`7<`7#=h7#81h71`76`7=`7#>0#8S >!0R1!!@RlK(@P[d4Q= fK@Pp 8. 0l0K0h0K00g0KQ<<g0K4 0h P%"%K#%KLK ׺0SL0K κh0[0h0KT @ lKQO~h fK⺺ 0 %K%KLK G pG~9OopB1?0!6&R!  @ T00!01R !@z9 UL I1S  lK@P lKO`P 1S01Ł! B@<2qW lK|@P lK0`P 2 f0KlK1 S@0m`l Kpd0 F1d Rd0 d@TA 9pP @ l K(hp 3d @D("(!h7 8.8S0# B)  /@QHDPDXD`DpD0000 㒣&>9 㒣&*9?o2|F8z?x`72x8sn0p:S| (0 3/c]pDD -LMP<p80%@`P 5`R H@0CR 0CR  R ? Rt79  R0$00`8 K4R :0R `t4R^ 0CR 0R 0CR^084R^ 0CR`7#204R 0R70;3Rq 0CR 0CR 0CR`78 3R +0CR3C4 3RY0 ^0p3Rl 0CR =!0CRH3R w: 0R r0Rp0 # ⎉zx7S `h800h -h80000g80( 80?x7Sh ,  㨸0+ᡸpo V0BP C200  R4l`8h3/` t(r v>0RP100Sh8D!01^0K`75?^0Eh8?B001 ``0EP D Nn^0`P V C Vᬸ@`U0"0|`7=$`00 0,0 i;00 Kh(0  0KL 0000cF%*CEh\D -L$M@ `F7(PpP`0'V`F``Sx ^' BS{ +? S  S  S H7p'S  S  BS0V SQp>0 ӷ  (803A0AS2'S  BSL  S\  BSV W?B0CS> &S&  SQ BSV0SQ h7 `70`7X&SJ ;. BS  BS  SV >  &Sk :+ SDV @0SC00P0S Q>⩎0`ⲐVC嶠C b ɷ@0X``%S BS*7 BS  S  / BS\t7S9 cP&1 3/ $S r SGp%VC0S@!V&R!: 1?0l8t7SS3A0AS13/4PpI V&3   R< h6(KR <35V0SDDDDDD0Dh'  t'St7p'Rh' h' VQ0t8 v΄0S `V2Ɓ0  RQ 0X""0\Q 0V >  V0S h7  `78`7t7Sx7S03A0AS7S7S4p`7  8`7{ <`7V0Ss V0S7lV0SV0S h7 ~ `7 ;Z`7D`7 U ;Vq > `7 K 6Vh0Sh( 0•b`7? 0V[0S.0‘"Ut7S2 `F LK<po B1S00S00 VYY6Y ,0K0 S C  RLK H0R@ Pp t8-%EO -L|M?@QpP ?Q l?Qv 7C0CQ  Gt?QU 7 0Q? 000`Pqh0GFStDDDDDDDDDDȹDDDD0DLDdDDDDDDDDDD$D Ñ3A0AS=13/1S|7v>0S2h7  1 CbR.0‘!8#8S'!!`7R00`7!`7R44!@RlKpPIh0[ S`[9YLg0[St7S>hX5 fKPZ:3/0g [l[Pp h0[S000ȅ%K" 0#0 !h [LK∴U f KPp 6[S>ñ:3/U K4W9 9 fKH PP`YF P!R?lK~pPl[Qt7S hHڭ kK➺P !1` kK @P MQo`!*RlKPpPl0[0CSDTDTDܽDܽDt7Sk [iR b0KhKPP EP hK t'R R0hKM4P`P@ hK @P lK1&[3/`:l K85t7S hK @P l0[S t7S P2P ` !pP 2䈄!> J!`7R 331S`75`7!R R R5ny4w5u1S h7`7:mx`7:i!`7R33c!`7R22h'P0402ӑ 10`7CPV!0B8#8S ȕNp@$1S7 W0h0 p WY㎐8 P 1S # "ґ0&!0B8#8S ȕ!18h71019괁 X KNpP lK⽲p'/o"0C,K`PP 6P\Š,K@Q@A0 SlQ 0, K!@ RR! 1?0l8 ,0K@PPlUP e lK03A0AS7S0 Spt7S' cpP_1 3/pX!RlK尊pPOX  P 03/P 1lK6S003/1zS#DDD(D@DW $y pP 03/Pz z03/W 03/W 0:03/Wd $03/!R\lKpP lKO 0PQ f ["F 6ii8iii9iiii7ii o?LP,i) Dc]0c]k^* *6c]U]^7h7, ㎈ᨈX#N.^ 1/pG tB W$DPD|DDD[) W$DPD|DDD H @981r9#i H 0Y9'90^00¥08100^00¥08100^00¥08100810?o200t7SS!0B8#8SF(ĕt7SS1 C=R.201:!`7R 0 0`7v>0S10x8h'1h"S8t#8,C("(R.0! lK`PlP[ U>0 9X kK⟱4` 0BSx !R r39S0Sk0 p WGppQpW_0R@ lK0 RTp Wp`:3/>0 00 0Sڐ0 00 >p 0P 0 9l0K0 O- P`pW:3/Vpᙎ00Sʇnp W0.0CQ0 `74`R$$  `'`'Rn lK=`P f`700~00 N00@0S@@WP00 0`PG0T0 T.`P > > 0S h7  `7 ;`7B`7 ; > 0 װ $`7P::x7S t'R `7   U h⺰1|&S68 S!V&R! 1?08l8x7St'R8&S h(0!Sl8Rp8 h(0!Rx7Spt7SlZH7 000`P 6g X  X $0 3/'`E{ 0-L@M,00 `pPL(00 000$ 0 a P@(0KဍP0(0`0$  0T0,0(0Ka0 nP(  5$K苜^aX_^ל^^ 0H2$,p(` ?!,2 0H0KD KPw>0 0 0!1$ 0,p(`H0KD KPb>0 0 0!1$ 0,p(`H0KD KΊPN> 0 0!X1$ 0,p(`H0KD KỊP;> 0 0 0! 1$ 0,p(`H0KD K᧊P'v>0 0 0!0$ 0,p(`H0KD KᓊP 0!0"M@$ 0,p(` @H0KD KP  <<G(K^HD8,_{^D ^*^6^A^L^X^^lc]c 0-@L᭦Pᝦ00 -P`L@T0S00`00C0  `iT --L M00  Kb^ -@ TL`hTwPPP IQ0000 ( QPPPg^^ -L M1P@` h8 Spp< 00,0 2Kh8 S,K⢬Xde0, KaH2 K,K⓬X0, Kgla0^^^ -LM1@P` h8 Qxpp^< 0hh8S 0f a2K $Ka0$ Khaꚝ^0^^ 0-1L@ _0i K0ha^^ -L8M`1P@ <08`000" 0p;Y  >K$ DK 80@ j0 80K0bKS070K"#K 0D Kqa$Kҝ^ -LM1@Pp` ;0 ` 0V00  &K ,K0, K 0Kk0pKFaK^ c]D^ -`pPL0S0 3SH0L RP@\0@@PL0 0@DTT@0 0p00@FT'OP0oT 1 # 0 Pp@D(0`F`(`/ -@ptLQQ F봒^ 9#9(R;fo49@8 #(R P , WB,@   #(#(0000C0`75`7$Kk%4u^m^ p-L M`1@ .;V00  0O"4V2< "! R 0 0 0S  ! 8Kph/႞^c]^ 0-@0L83/0P *4P *K0h) ) -L M@:0 2 2" %|000""? d:01 0080-D1 < Khꠞ^^ܞ^^+^V^~^ -LMP@3P`1 :0 0C00 00S i V1Sp1 :0|  0!6oP R 0 0 0S  ! 00KKh&c]^^^ -`pLP2hHP |0 0 S*Q00@刐T -0S 0C8C8S0 1 1:0 Vx@300輻pG^ -@L`1 0 <pPUKh2S :0S 3/"42< "!Dc]7^ -@L1 0 `220S~2$Kkz21S 0 P0S(00Ppc]W^d^ 0-<0PRp(L@0!qG ũ0U] -LP0`VF0T@8 "@S 0!S@t'?R `'@0 S@S(@Rp 0RۯP @`7    ЯP @<1S1@@F @=T+-W9 Q9  ! z06 ! qn ! ?g?0 ! xZ?ppl0 ! P%L0HHGU]^^^^^5;_^}^^ص^^^_0^^ -0XgnLU@` - ᧨P v6P5v61Pxxtptt1 S2  PUp4$KkeU]c]^Ơ^^^ˠ^ 0-L@P1PLL000AT  PH0@ d]^ -L MpP1@` 80! 0 ⢨0 `00! 0>020`003/09909*= 20T1100 0 0 0@0 01 `a R @`Pp Ki;1"d]^U]X] ( @0( 8408008,08088> 01/LDDlEDDLD2 028 0/202/ -LMQp8040#Qd78d7 .0 41 ( ( . h  K 10-L@ `70 0 ,00( `7=`7d78d70۠^^t^7d] 0-@PL83/K0hn -LMP@` QVtxw v> G" Q!PG/  R 0r0UKx7SD1@1  UPP0< <!G?0 R  ^^^Md]^ -@L`8p3/PP\00\0   p-L MP8 `3/@P\00\0. 1 h70  wh r00h822h80!P0003/0990920T100PKp`d]J^X] -PL`8p3/@P\00\0  h8 0 0h822h822h2h80!Uh8 99 -P`@L/>P/ 0-LP@P hG G1S 3/0 -P@`0L0p0   0?0?h80101 M? 061071 N? (Q 4$Q 0 0 u1S$Kk/ -LMP ` p_@P 00 0YK -t7LPSS` `7M@ iN@p/0 R0S P@hHN/ -L Mt7`SS@ `7]P i^Pp.0S TAT10 R0S wP@hHԟ0S i V1S1 #60D D0 0EP⹟A. Kⱟsd]U^ -@m`Lp.t7S 0 hX⛟.U t7SS PP ⌟$P1 50 000d]}^ -LMP@@@`po.AT ݐ  (P01SYP1 50, , 0.$K@d]^ -`LPV  R 0S RpPpp`/.@Tk.p P 0R01 S  R 0S R ΫP0 @0WpP -LMPp@`- ᴫP@T..$K0S ⣫Pמ1 150t t 0T000AT  ∫P0S P @d]d]^ -L MP@U+ p-P  Ki-0S0S i V1S1 40D D 0!皋P  Ki Kd]^ 0-@hLP 0h8i 4P #048@P0#0@80 -t7L@SP m`L-088$8-hhXP 0 02222000099}0pv>01p8C0t7 S13/ӡ^ -1L@` !]Pp-t7S118888$8E-PPp j( ch8 """" 99>0?`7?0?p'RM?6!t7S`7<`7?0?`7 000  4 Xphv>!QGQ ⦝$KkLe]ܡ^^ӡ^ p-LM@PhQKp` TP ;P 1 <10<1x P 1 3`'`0` 0LH  0 0 0`7<`7e]^^J^0^^^ -@LAMet7S<IKin  `JA,VU ~,1V6 S2 0S! q $ K !RRPq  Ki83/0\$0K1PPS@57S &1R6'S "t7S`7 8Sli^ P+6S .,;`70`7 Kije]^ p-L M07@007t7PS`70<`7000001 0`'t  070d01`  \MU i^` P*+3+`70`7Kphqt^ؕ۠^^ -LM0i~ 00 0p`P40 @P83/@P\00\0  |h8p 0 0h822h822p(Qh8 991+ `7( 0 80 1 80  W#2 "1" W 10 0ST 00S PZ R 00 z 07 0ڡ00 0400ҡ0?0?0ao`0a M? 061071 0S ;!0:1 N? (Q4 4$Q0 00 YW(Koyp}TP0 X 80 80(Kڢ^0^ߢ^.^^&^4^ -LM`@]P*pP*ᾙ(8S$ ,(Y! W a !7*V T  \#P1 ?10< <0C 0a%$KW` :^Re]^^ -2L@P n00C02021 10 <p2Pa 02HQ 0SH1L1pP10CP1HP HpV 1S 3/P,RP ,PpP`UKhtꕓ^ -`pL)PPP)x)0U x t,Ko))i)@T 0U PX) 9/@ꉣ^me] XD -|2!L@0SP` 02 9H#9tQI031 h2Sr :0S 3/"42< "!0.200C0v>0SU? #~Q A1 ^00 h0Sh7  t7S 1 0!0s2+~Q A1 700 \0S1 R`76`7h7  1 x E`767`7(V @([Kh(Kh@^^ܣ^^e]/^U^t^^^ -LMPpt7 C/oS" 4 (```(1 `0"(0V  (Ko(( q(@T (00(K0V `t7S2  P D"|0 08" S*0G00h8S =00 0-0C024 S RT P1S: 080 ! 8<0 /<0 00HP 0SH1L100P10CP1FH1S 0 R B0 Y 1 i/ 0 1P Qܑ13/000S(Sʐ1  0  1(h000Sʐ1  0  (2S 0 9/000I@Ze]^^pG^^2^^R^ -LM2@SP` p8#8^ q0 7/ KiS4    924Ȕ2<!000v>0SC p!,20S .`ǔ"  2 !W0 1S 3/8-8C800ᬁ0 8/: 0S 3/  Ki? ~0001 .0 @GjP202~0001 y.0 |7S 1 `76`7? 1 _.T `776`7rpq@^J^0^^^ u^%^^^e]^^ -tGLpT T) TgP hP 83/@P ? 83/P@`VUP@PgV 83/P@`@PgV 29S 83/P@` 0-@L1 00 0"P&00K0h&e]W^ -`iN@L M@PdhXwUhH 0n 022220000990?Khi^ p-L M^<2 @R0ŁP`4`!=P@>`1 0!01] G(& $&07t1 PV8080$8X1W,h08(h \P( (1 0 01in F % % 0(' 0' 8' j^6D'@7<7VZh8 h  h'     T (  h8 Kpe]^^f]Ǧ^^4 Eަ^ ^D -L`pjp@|PQ D0QA T T T T ,TH$H@3V`h@&h` 0-P@L s000 0u t      @v w 0  " @x 0S @@0 f]0/ 0-0 0SLP@0.t'RExEEEEEE0 0 ⻜  ⷜ Ⳝ0002100000 0⤜  ⠜ 0 ☜  ├  -LM@P#@`P000% $Kp0 Pݐ0=0H0 82 t7S0000(001011 D,pP.0X XT00 00_00L7S`P7HgLg0P7i^^^@-206 2S 101, ʠ,ʠ\1 016300000 @Č\ 0R  R (R R S0t'Rt@ 60R R R R 01 0S ">)R f] -LLM0P S@pL^ <Kԛ`7 t7S <0["0(Sᘀ*.Ⰰ'X )#[7R 1 <K+>0 07000>Ⰰ7X 0)h7R X ` #[@7R```7 @@ ``X80  #RH L0S0P 00H  0C IRt?@P0@00B(KY p @?0X 00@0  B    0@@  0-R,@@T R?U 0      #[ "$  (0l0  #RH L0S0P  B@P000  0@KtBP@ {B@0H  0CV00C00000(00(00000t'R"E!E"E"E"E"E#E"E`&E0 0 6K ޚ <Kښ0 0 00ZD 06\  \  \#*9S00w0 00#"!# #ᇮ0( R00 X00 <K⣚ 6K ⟚h 0 0<K╚  ⑚ 6K321303St 800L0 0H0 L00d0 0S =(H0S !%*0h@ T0 0T 00L H00CX0 X (0` 0C\0 0P0 d0\ H0 S1p2Y dYK o?PH L0I> T CP0` 101P00P0 d0I0 0>00(0080h0h `0 0`0 \0 0S\0 000(X0C0>0P 8000000C001l~00 GG=P6 PhAX XL o 0[ Q `'b t'R8 Q[  @  8 QT ( H0 9/PH0K1 <K)H 81081K^X]?^HHtPP t7`'S000 p(  0/  h' ;0  W000 0 . 00 h :00000 0 G0 0 `70   40S  0 Q 000 000  000C0(09W PW0 1S &0 000@W W1 &0 0KPP 00ᰀ00(0101``0KkPP000 @ 0]h80?0 000 t7`'S000 p 0 ;0h 0 G0 sp7S000 j0000倦 0  0 M?0 0 0#40 0p_0000 *#300pU0000 *P #à @00 0 6! t7S0 0 0 0 0 0 00 0 0Y 0Q0 v>0S*00 000>0` 00000B0 0`70    70 0000 0  p00 0 8H#8 CR,S  R Sh(  B/o"YQ8 0K @0 < PP< @00 0 0 岀8 0R㴐 #80 @, 80S 1 %3 0:0Y(110011t7S d #RH L0S0P _ 7=PPe30KPP `'00 p 0 0 ;X000 0 岀00G 0 " 1 1000110 a0 m`70   40SN00 0C0(01 f%0 0KPP 00尀00(01010H  0CS00S 00C00000 `(0 0(00000=080r0 /1 PWt'R  !%1Grppq 0 C1 0100L7SPP7HWX0P70LW嬈2A@(K, R :01 $P0 L0@00^f]^^^^3^2^^f]^ -`Lp8PP 00(0K0@ 000pݔ  ٔ -`LPk8@P 00(0;0 00`0 -L MG` h!=0- 0  p@ 0KPP 1S 0|#|000(K 0%00/ t'`0 R    0  + 0 `0   i00 00v00 S 000 0000 0  0'00 0 000t'RV0 000 000 000 !0 `7   -`70 2`7`7 00 0S*00 000>0` 00000B0 0 00@1 0@( 3SH0LQP0 j;PP    F  00000 01H0 00BS00S  B 0(0 0(000岐4Ɠ  “ ⾓붑%f]^ԩ^ -@LMf pP>t7`'S000 0 0  ;0`7 . 9) R*!  $"$8089R:!  !808x09`7  n`72`7t7S```D >P00 U!=0PPS@(Q PU0C0(SPCUe!0 R ! 40 堑 40 Ⱁ P@!-`75`71 00x 0 10S00C00S0  R  R00 (K0g]^^A^S^ -LM`T1P!pR@X10X11S "20 0X11 0 GKhH:>0/Q?U0P00L1EUS0 `HaPE0PLaPa`Pa1 "` 00V1Kh/K耪^^0 / -2L@SPa0 6/Kh 0: 08x880 |80|77090t(10101/* * EEiDL/E 0-:L@0S 3/ `:S00K0h/ 0-hLP0ST0T    00U 00!@R 01m000,g]P0/0P 0!/0 0-@L M0@0ڪ^0 R  @^ 0-D0LP @R,:@T vP@0^ Q-@` `PLU tp`PT \Kh0 0C^SP ,P$p0EVY^^%^5^ -LM1@pxg 4!1000$xhXY lFEhGEdHEIE|IE`FV\GEFE GEFEt7S S 0 8:0S 3/$Ka0 6/  t7S S a0 6/gVGEGEHEHEGEt'R/I032+P3Q' `7  (1 J!  pW`7<`7hi/P <10$1w7SV񟗘HEHEHEHEHE0a 6/Wa0 W W&7S}a0a 6/0x7rVo(IE(IEHIE(IEXIE1Sg !b0a 7Sa  UV IEJEIEJEt7S 1S   7  P2  t-d` #2\1"Lӫ^۫^_^ ^^^&^+^.^^5^^^^^^^^ -L$M@P` t8sP0ᳰ0 @ D < 40 00 H L Q0 4  Q R?o2040 (K@PD\(<\ q+LPD \D AG Q5 Qp 8 p Y8555tȖH  \0 W X PtP00 \D!4  `7Q;;`71S// 0-`7v^6`70L@S St7Sh!0S`7 h' 76 67`70@-\L0 @T B\0S lg]C- \`\Lp0BVP0\00@E @DY@T00 g] -LM@0 &0R!S"T#U9k:l;m<nSt7S[8 `7  v>0`!!h740!qX r Y sZt9[9 0W901 !\0̿t7S!>0S8v>0 01 r9Y9 00 \0᱿t7So900o9`72`793/1  t78 @S$9o9Kh藿h82K,g] h]0^u^^ 0-h7L@0f_nK0h; -LMh7`j Pp㤁v>@WAN WP W!N|10@t'RL %) &) ') ()0)91  )90!00(9 0'90&90%9011B0>9 ?)@A B  00  1 *pWPh8S  7u $Kk0: @X 00: 0%90&90'90(90$Kh]`i]Jh]i]^\^h] -LM`7@!1  tQx7S8(00S8. h (0   K 1(Kh/@G^^ -pLMP`K` ᩍ0K@K0 0 0` 00000 0\@ c0P?o2^ 0R: 0R : 0R:0(K -pLMP`K` @f00, K0d0"0\ ` 0 0@ 000 0Kc?oP20S R0 (K 0-LDM,00 `@P(0|100`$ A 00KprjPJ<1$ 000K ,`(A ajP91$ 000K ,`(A QjP)0'00开$00 0,`0( A0 K ౓0 R" .P  0PQ`p!P 00  nk P P00 (K谖H^̖B^ -LMP0p00@P.P~ 0S} S} S@0b RL*A001QC0S  1 00 .P00 ⊠0* 40 0 k400  h000!A\> %0S- `.P 0@@n0S Q.P @3@ ]㨠娐 V@1S ʈO XP(K@@0a01` 00 j00 8@갖Ht^̖m^^^^.^ 0- @LK0h j] -LM 4,4 8 #8 Kϯ^ p-LM@0PS` Kp (K0 0(0Kد^LP/D@P/00S/H -L M    0 a' KD* -LlMP.@PJ ,1P`0pP0P0(000` 0```p  ⛊ ◊P 000 0C0`勊``QL  00C0000 0P@xKS2 8K0K0@0s*囿$`pd埿(KHxD* 0-@DMLL 0H1 00 @@P㤿 1 0Ppl!0 000,P(p$@ @@ @`}g 0!0 0040P,P(p$@ @@ @@jg0 400!d080P0X0,P(p00$@0 @ @`0 RgA(K)^D*^^,bEM_ -L4Mhw@`P # 0 $0P4#(X * !@PAD10 0S 0S*d1`P@ !`pa(K0 H p 0Cp0KP ߾!0@K 0C00 00MP 0S S S5ž" 0"ƾ3'0 4R8 00ͽ$ 0$ν0S -:S+00(0 0S0屽# 0#Ჽ3 $ 04 8 < R $(,S 卽# 0#Ꮍ  0S mP `0#$ 0 #(#< 0  048 r@P 00_$ 0$` R02& D*)* 0-00L@4S 3P1 R0 0S`@`2)@a0SLP 000 010S100 )*  BR/ $R/ #/0 0S/ -L MP@1S `pKf 0,K@1Z @Ta  K0S 0CS0@q 0S0 0S,K* @)ع -L; @0@1S Kh6 R  R 0) 0-L@ H0Q  0T S    K0h )01,!,"/0!,21 ,/M!4! #4! B#4!0 PЍ/60S 000!S <S21/ 0-@PL ⸆!>000000 -L@P`LBT D@DT00SH@+P/. 00-@LPP >0 00-L@P >00 -L0  KhLH 0-@PL4?>K0ht -QL$Mp@`0 Y@K`P Y0(KV` @ @ PU0B00S @T@K B  ?00S 000S0L0  P0 DKD0 0U\0P@H@ `X 0H0 0 R0 LB\0P0 ;\0P @@K H0   @H0 -LM,0P0PM 030```p 1@T @DT 03  0,00,0P. 030 00V(,0%0K`G 03  0,00,0 03  0PP,00,00KK@X -`0LP@P`p*V 4 0 S H0S 8 R 30 "P SH0W 0S 0CLP 0PXZ@P !  " 0PP %0x0l0H0='zZ㰆 ,19 06 06 =^J8rE -LMF`@Pp !> (K,0 t,0K $@ @ KA 4 #4 # /l0Sp p l p0 0S  0 00/ -@L{Pp`1Sl01l dp oALk 1` p P 00101S@@kqX@-@dd$,d,lH,$@l  .  -@plRl2@ML p00@@ K0A100bA Ԩ>  ̨ Eh F? ¨< 0P`p!10 00p,P(`$@ @@ @ b0 000!X10P1 004p,P(`$@ @ @a 0!10 04p0@,P(`$@ @@ @a0 400'!0 008p0@,P(`$@@ @Pa0 400!l08p00@,P(`$@ @ @P0 a$KX^^lrE^%f^Ж&^6^ 0-LMP 0@0T@0S 0CS d ` R 0\0X 0S @T @DTK0@ЖX p-`L MP 0L"@T RD0B@  R\ X R H0S D0CS@00Sd0`0S H R D BRKp@Ж0SM 0S Ѝ/0 R/C\ 0C00/0 -Lft 0S0C Khy \ ^DpUT 0S 0CSR$!X 0-P @L< WK0hx l 0-@$PL. 8l 000l 0-@L   S K0hX (E 0-0@LMsP @% L2S D0C SK0QQ Q hQ R `Q XQH0S D0CЖ -LM<0PS 3A0AS `pLBT D@DTK00S%0KT0 00\P0 R00F80 0003/0Kp8H@ p-LM@P`LBT D@DTKp00S0K0S 3/0000 8j0K`H@ 0-@Ll1K0hQu 0-LM@ P <801PK00S 0S X -@ L M@ 8:@ @;K@@x -pQLM:048 `P 000:$K=@PH  f00!>  p0K40 ]4 K,` (` P :ҽ@`.P :ƽ @`Q k1S0 ` c1@0D \A0, V(1 0(1:X1ix 0-@LM":PPEUP v:K0-!> K$0 $ KP P P 0$B 000KhXl -L4M@R|PLKS⌀`pLtMQpP` t.t.Q #B%BQY VP U D.U !BU< R R   pN  @ TU& =U# 1CU 0 \K lK\K 0S LK !>8K3K 0Tl Kp00 |0  K1!(00R|0 PLBTD@D|d1p<U Ks1!8|0 0SZ 0 80 S H@T D@DT )0Q 0S0 \K lK| \K~3 LK wLK s  0l KYh 0 Y @ lK C@t{UL )h;U 26UC 2C6CUw UP @(;U 426U 2C6CU ps:U 0UY~ :U0CU6C20C2:T< U( ~:Uc s26U 2C6CUv pR`:U 0U0ST lK1ᴡ -:0AT @DT9)UU00U0S T[1p@ 0 S0Z/ @U0S00T }0SZ |~0S9U0S /p괡18ဠZ(8UU  0 \ T800 8 0P0 0!PTpe@P 0| 000?893 !>8g4密000000Ug -7U 26U 2C6CU7U 0U `V~0X` d000 0`  p@7UX 0U (7Uf| X p"6U< 0UV|K00 |0Kp6  0P;T) gH6Ul 0UT6U% 6C0CU 60U5U 0U 0CU3H 3@ 34 |K⌠ }  pP |0K(TX lKd ,0 |0K0 U( P(t3 p00 0  +pX Xd !E0t01x0@t010S ؀SS `0؀ c?W 0pW p  0]}0d030 !0Sp0 0 R00 p pp  X  0 00 0   p3 !0S /} 0&}3  R    0S}|00pClKmH2 @0S 0S000`S 0 pc`r0S -WZ 1 p 7p p-p01|U@ | |-  | @P( R0p10p`(KlK0U 0U 0U 6C0CU 60U h0U 0U 0CUvUZ ii iH^ii@iiim^#i%iXi@'io"i!il[>08 P R/ !  /X !  X_4x4x5x -LM@Pp M#`0@01@@P.10S@CZ T#100@ !>8K<0 |@0K <K4@ 0@ d#`P H03H0LBT DDP*@ T 0X 0B?o20S5 0S2 P @ T 10@0"(KL@T H@ 03 @T @DT@P 0  t80S 3/@P X -L M@  048<Q-  048<R$0S! R R R p00S 0CS5K #  $(,R#0X -L`㐩P 0@0L0`0D00@0 0<0(080,040D00040,000@qEuEqEhwEwEpE rExE 0-@LK0hc -L4M0,000 S@("@P 000  001H0 0PH T080 0S"@P 8 00 p t )x 1P0 80| !0@0 40 @40 1!`P @0 H00 40H0! 8#< 40#4 0 0Č0Ȍ0̌04 8t< ,Ȃ#Ȍ00 Ƞ%$,̠ ČD ȠT,Ƞ 0#8Sv,P4 $'4,$8(#8"(000010 -L`P,㏯@PE Pu00008$00(`088,P@K0 ` R 00@&P4"4 8#8 ! R 0 1  &4"4 8#80 A&4"4 8#80 1 057舆 -L\M(0@Ბ0SP,`|  RRd0&KP 0  00 "p pپP d lK sP^d0@0d06[0&[4"48#86K60S   &4"4 8#8 ! R 0 1  &4"4 8#80 A&4"4 8#80 1 0#"44P8#8 S0 #0 30 ᆾP|KlK 0|KᥛP (01 0(KH0[  10R<10S  0$P5H0[6 W 100S 0P (0(t R!  x K$0 Hs0 0 0 $K(0K8K8: -LM0 4 8<< c#,$c4"  #$  #(  #<  K^ p-LM@0PS` Kp,K 4"48 #80,0Kйꌰ^UYiIlMl Q 0S  0CS0#0/Q 0S  0CS0#0/ 0-P@LU *U  R B"yP0E0T  -LM40@ R  K 000 ,p<K -LM40@ R  K 000 Y%K%0 -L M    0b" K耈 -pLM`KP` @or0K\0 0`@0 0 0 0000 0UH?oP20S B~Q (K耗 -pLM@K`P` >r0K\0 0P@0 0 0 0000 0$H?oP2PPU@ @T@p@W T@<(K@T 4@* 0-@Pp`DML!p3$@ @@ @0`0 0,P(p0O 0!(3$0`$@ @@ @0`0 4,P(pO 0 0 0'!24`0`$@@ @0 08,P(pPO0 400!|20`$@0p2 @ 008,P(p PN0 0 0!(20`$@@ @0 084p,P(pPN0 0 0!140`$@@ @0 08,P(pPN0400 0 0!t10`$@0h1 @ 008,P(pPN0 400!$1010`$@0< @ @0 08,P(pN0400 0 0!00``$@@ @0 08,P(pPwN Q1wP@P7(K^^^E^^ư^@EҰ^(EM_߰^*E** 0-LP $@tp0 R Q L@L0P@0K0hP K0h *0 7ꀈ -LMP@000 6!,21 ,2 048 P 0S !`\6V!,210#,2 (K0 0  0p+`x501Sw РCZo:Z  hK|K*ppZ  R` 30 L2 Sc DCZTZ| X  R4 !>  K0 Yp( TK℀ 倀 hKo0K0 0TKK␀ TKVZ (ᰈ  nϺ hx|401S3 РCZ(޺Z| XpW8 LX- DpHW ( X 0  R R  H0 X V 0  RHhK| ᡺|KVX {@3`0S ؠCZ'፺X%  o Z  hK 01CY0 `kl `P ^`PD   o 0 1 # 0ShK |Ru S" pWWQDRRR  R  0 m 0  0CS R0 s 00bRSJ0 $4"4 C8#<40#400 0000 (0 B C0( Bm90p,0,00  PPQ B p04#!A 10pp0C00 PP07~p 0S   hK LhK H  D`Xx -LM$KQRK0 03m/V0`( "4`#KQ -LLM!npPh  @ZKn JKeKndK04# )IY ʄV "`pbC$Y $0S 0 3SH0L0S\@P F"`pb(KP0 0C0x0P U֣"`pb00000C00(Sheţ9  0 ã 0 BRwEEEHEHE\EHEHElEEEHEHEHEXES1\EdEEETELE\EdEdE\EdE\EdEdEdEdE P#Y 00S00 RY% 倣#r PPP PSPm!q*SPSP P0S@PL   00S ,|1x2120d#0S  3/h O$30S 0  -$00$# !-Y#x20S 0  %00 (2 0S Y 0XK4 8 <0Cs  mFDiPQ Z Xb SS_ʈ0S #Y00S!00 RY HKm0 X0 1\K 21` 2`0K0L0K00W`P 0S  PP  <K-0< KӴ4`P M\Kl lQ 0000 04 8 < 03   ?mꀈ|0j]*XE^ -0`L@]1@$Kk^ꀈ -LM0 pP@P 400( K  0 P $K(XP Xm(@1 xXd'dh&hVp 4"4 8  #8WS  R  1CS0PH0@0!aV:X`؅0 JV:pHWV 0 %T uH0@Tl000WV03S PPԡ$ءf003/@ꠗ*Ek]h 0-^ 0SQ !R R:0QS  0C!k] -L 0mo耗 -LMpQ`P40 P C兡  0 冡02"0 4`0S XA0B?o20S  0R:!R232 |B\!`(Ko 0 80 P0 $"44"8 #80CS00 RP:P01@ T00 1K00 ŜPTP0 @(@2(X2 崲 VPLA  0 0CX@400 0 X0 XYZ 8#< 00  0 0000  40#400 08k k 9@P _Xgꀈ/^ -xL⬙ Pe@X 0@@Th`pTVsఀ0@0F඀ 0-@LK0h腙 -L`P:@0 P @@S @08@H #8S00 (0QAA  P/ -L M    0" K* -pLM`PK@` k0, Kd0"0@\ 0 0P 000 0@?oP2@@TPQPPW(K贗 -@LMPpK` `j, K0d"\ 0p  0 ` @0P?o20S00 6P00(K贗 -L,M0p|L P`,0 Cǟ%`pe˟(K048 P 0S0 p!>(C 8K<0 tj4p 0p 垟0 H0 <K@0KHP坟 0  04$#$0("(DRD P 0p"0C0H0SP40@M008L 0LS0 0SD LPA 0 4 8 -L M,0 0tP8 ( p$0 0 ˞`00K ,K@P˞KLL* -LM$>$n > P>F(Kl TK0Pp0 D =0S S M呞 啞l0 =   GPl |!倞pTKlP0SPl M l@P0@S ^+@PKPQUR"@PB0UPl @ 04 8 < R8.@PN $(,(b" b$ ",R c(#"c4!#<Sp03 p0l`1, @000@S S @P@p03 ;0S *P04!48#8U"@PBl(S!@PA Q0(0 C ,K@ 10;0 04 8 <0 p 00P0 lP 0l0 忝 @P@^0S Pl 寝!@PAOl001S|0 M0| RPl C  04 8 <0 |0S l0p0  0P4 8 <0 0010C0 0@0 0 0 x0 0STh D90S@a 0@KPP[  @K0l0 Y YJ 0S@/0t0 t 0SRQDY Y 0t 0C0 PY Y bKg!>6KH80Sz 0S @Et0SZ@@D  `Kg~ dK0Px0 0Y3@0 G0p* ~t 0J R*+Z 0  040q 0P 0 g0J* r 00 @ `KgY@KdKP x `P  `Kg g@K 000@@@T@ @ bKg!>6K0S|t0SP0S~t C0R: `Kkg@KdK0Px0 x@K`P@}   Yg@K 00000 ;0SOt00C $R! ROR0 #"  02R0D 00 " B0 S  !:S6 @E@7 >Kf!>4K0 0S*0<0 寱᭱0P ±x0S  ά,K<! @le000x0 f ᪱000 >Kf!>4K0 0S <Kfy@K0Px0 t k3pPU 30SPp0SQP%P0@`D0H0LnD301S 0CS!p0# p0L2SD0C O\000 0SF pP{ʛ%@PEj T U  pP     ^ p #Z0Q  R TJ hTG `TD XTA Q> H0S D0CS@p610S TKp%~%@PE傛l 0S TKp0 0lg%@PEk0lp STKp0p0 ѰTKp0 40S lKKPl0S 001|0 9'@PG=, P0P#| 0l3/|@K+x ع*XHܗ`|0j] -LLM89@P`p000`,P(p00 $@ @@ @C84`,P(p00 0@$@ @@ @C4匘 0 00'!t88`,P(p0P0 0@$@@ @B 0 0 0!$88`4P,P(p0P0 0@$@@ @B0 0 0!78`4,P(p0P0 0@$@@ @B0 0 0!t78`40h7,P(p0P0 0@$@ @B0400 0 0!78`,P(p0P0 0@$@@ @B0400 0 0!68`,P(p0P0 0@$@@ @wB 040 0 0 0!h68`,P(p0P0 0@$@@ @`B 040$6 00!68`,P(p0P0 0@$@ @HB 0405 00!58`,P(p0P0 0@$@ @1B 0 400!p58`,P0d5(pP0 00@$@ @B05 00!548`,P(p0P0 0@$@ @B0404 00!48`,P(p0P0 0@$@ @A040 0 00!l48`,P(p0P0 0@$@@ @A040$0 0 0!48`,P(p0P0 0@$@@ @A0403 00!38`,P(p0P0 0@$@@ @A0 400!h38`,P0\3(p00 0@$@ @ @A040 3 00!38`,P(p0P0 0@$@@ @vA 0!2(p0|08`,P0p00K 40@$@ @@ @^A 0!d2p0pK0X2,`$00 ( @ @HA 0!20K02$ ,`00( @ @2A 0!1,`010 K0(0$@ @ @A TP  ,l hPEE1\1`PP@ T@!0@Tp +(1 1 0 (K R\\ CBQ ,0^%f^:^E^N^ ER^\^o^z^.G^ؖ^4E^^^*^α^ܗر^EM_@^^G^܅G ^,G^hE0j].|J* 0-@LX K0h.عC -L @PP0S PP `0 010q;c00  a`p` W*  )c pG`Fc 0-@L0S0 000蘈 0 /ᘈ -L8M`(0dP@p  '@ 0 ,P@  0 ,P@DK`P$    0Kb2 ,0 00K,P@ P"0 PPPP0K0 0[0K,DKK -0`L@1@$Kk*01,!,"/0!,21 ,/LP/D@P/00S/H -L@`P@P 2P/ 0-0PLM@P R RKe%Kb%0[0 P0S0ĕK0 -` LPR@  RP PRܬpP1P 000\ Q 3b0 0!0;0a 0! -l0L0S  PD 8#8!P!00 ؗ !>0- PL@0Pa K0ha -pQ00`@Lf8&#DfD$$<PP W@d j\001S 0CS V  P#RP P0` -LDMPpdK `$@P"d0 R@0`0S'X@ ( LK9a\K\KLK@P LK`P 00LKLK KHP GPU``KXP%1@P 0P00< -`SL@P  pP0 $Kk/|P/ -`0PLpPQPEU `f @ T T@0 @U@  &a0PEp -L,M,0@PD0 0QD01<0 04 48#8 :T0 \1 P 0D0 <0 B0S00 j(@(K0L0 0 <00@0 40 0H0 080 04#40!SE@0C@0@ (08#<4 0#400 4 00#40D0@ <"  ,0@0,0X@ K 00CH S  T R Bܕ(`ph7@ߕ000sT@7pP dBĕ(`phȕX7@`L0 p0L0 2 ``~`0! 000<0S (080 8  0-0"> 080< 40400CP 1T 08#(#< 004!408#8Q :0C0Ƶ#400 0Ƶ 04$4"40#48 000 80 #< 40#400  P D0( @  8!  匐N)`p 0)PH00 0H0 40040 !,0@ ,00,08 00800p`oPU*Hv -QLM0 0@ 0  0 `H$4"48#80S`:0P0 P 000000pNC10@00'`pg0S( TKX_T0K0 K0Z 0S 0 (048<R  @P @PKPP.K0P |K pPmT]`幔+彔3Pp 04 8 <  t_ 7 #RH L0S0P 2PP 0 0C00 0000x<@0P_(0@ 0(0H_00 0 $4"40h&ld`&d`Y0H  0CV0h 0 00]P10 W `@00 000PT@  ` 04 8 < sRSs<< 000S00X0Z"+&! 04 8 < sR 0 \ 0SY PV K`P lZp+3PD|K@3pP9  04 8 < sRy 0,PPr3o0wPhT@P H0S Yɓ+͓AP$400PW%00 `qTu@P Y姓+`pk嫓pAP`LP He哓+`pkp喓AP`@|KLd`04PS0 @00 $0 W0P&0  #R>  39 04 8 <hKPP 80S hK80K3/PP hK@ ^hK0 48 ]P3 0S 0S- PP( 00SPP ,0   ,0 0,00 0 00  0  K0S 3] 5P|KB T0KRV K_ (K 04 8 <80S |K!80K3/pP |K  ] 00S dU徒(’1PU 3 0  04#$S R0%<#*(P0<00 0(DQ  ,   404#0 @0Ae, W |K0 0"5 0 4@00#400 KPP R s] @@`p^ 0  00 0K| KKpP03 `30S ,0@0,00 $,P4"4 8#8S : \1P0 0 0,0 "@ 0   ,0@0,0 3  20S 20S  ,00,00 㰠K 0  PfW 3  20S 10S ,00,004 0Q0  ʑ*Α# nPP Q U8峑) 0)嵑0U0  00 0  K 0Pp P PO RL F R  hKx0x x141x00h0Kⵣ4r( 0(sX1P*H*ܗ<ؚ$tl]^ -LM`@p  ((tTK0S  SP S0#03R0S0S 0 00000 000B00SQ QR $K[0 $KP R 0 0$0 * -L,M@pTP \㙉@P7P4 0@#00 @0 0CSF`FxFF F <KPP<0SP C8K`<KP 3SU1P0S  2R`V\ᜉ` K20?80S3[PP03[0 P 0@0 0S08 K0@K<0KPP+@Q' 3S$`< 0V V;P08 K0@K<0K֧ ^ R `<KaP 0007P1P@8K0P`$K@` `!0S`@0K8 KjPP`<0@ V1P 1 0 `aR0C08K<08 K0@0K⋧S S Q ` -PS p-L M0@ SP+ S. S- T 0S   KZ KKp 0"K1Ke`P .P0 0  @ KZrP00P0 K0a x -LM080 0P`Sd@ H&S<6P*(KP Pk00CS~#F )F$F$F$F$F$F )F&F&F&F&F&F )F )F )F )F'F&F$F )F )F$F$F&F$F|P u0|00SC  @0 pP@07`  @0 Y@0`S)Z S `VSK`ZZ0VD0 0 @0 ?Z `F` ,RD0 4Z@0`0|pd@(V &Z8K(P~00CSp%F|%F%F%F%F$F$F$F$F$F$F$F$F$F$F$F$F%F$F$F%F%F$F&F80i080p080 CR0ŕ80S@@80S@@80S@@80S@@80SKK8KP80SJJ 4KP,00S3[83[8 X`0}Pn1P 8888cP~ 8KP80S3SS @p - @m8KP8W0 CRw'F )F'F'F'F'F'F'F(F(F(F(F(F )F )F )F )F)F)F'F'F )F'F'F(F'F|PB 0 P 0CSH(F`(Fx(F(F(FP(FP(FP(FP(FP(FP(FP(FP(FP(FP(FP(FP(F(Fp(FP(F(Fh(FP(F(Fi080 8wp0000D600D135 R R D8 000 84K3K83K9p&l  0$*s  -@PL `P0S\KhP -0@S L  l0`  B   B PUKh R0 0 K 嚚ꠈ -LPfXp̀0`ATp@W< 00C@S𫝘@p0S00C0S0܍$ 0$ݍ @1!  ꬈* $1- l0@PpDML!0 000,P(p$@ @@ @5 0!0 0040@,P(p$@ @@ @50400 0 0!P080@0'>,P0(p$@@ @P0 5(K蠈^%f^S^ p-@`ML0P0@@ @0 qhP 0,@@T "0 Q  B! "Kphb^ ,-L2P54 Khꨊ -@L'0"0R S  B! "2 2R2S0t`P"0#Q00S qPP@UP#00C?o2PKhꠈ -LM0 p 04$#4 8$#8 Ƞ $ ,("(!8 8' C^ࠃࠓ^ GЌ,`pl CSP |GÌ-`pmnj(K0C40 0@0  40S (P  04 8 < #"   "? < !AT#唌# 0#ᕌ6 D0 D0`PP#00 ~M 0-傌00 !R S  $(,R  P: @@0 p00080T14010 01   0B0000_2S S?$@P: 0 000 001<00 00 0 0410 0 V V<0!0Q1@0A40000S0 ``0`0 `Vn   Rk  !Ro8T-00`'1p01W 0 !1Rp   !* !! Bഡ R*!AQ ڴ! Q Ƞ,Ƞ B! R Q   p 6! B!  B WY R ` ``! R 000!` R  B   B  ` y pW2 p !p8 #<40#40 ,V (V@0 0100 01C0T00V(p,@`Z hQ>(`phBy0  40   34p0@p 0`0PS 0R ,@PLR00Yl !Ს!JZ7ڴ!Z)10C10X@0C0#0 #, {&X*-//-/-/ 0-@L-0 p-L MP d @ ` d0 (01  0 Kw( 0 MP(h P Kp1M  # 0-@LP0S 0S 4P00qP0*IP 0贊 -L k^ -Lu^ -LM!>P@  0K40 2U,P (P 0 p$p4"4q0C0#40 0$4"40#40t1`V U7 04 Kn$K0S*q0S S%t R 048<Rx R  048<R U P 04 K?P`, 0x t # l0Rd@0 Pd&`pf'`Rpg+괊|0j]|8F*\ `P/0 !`8 0 0 (  , !/,LP-/ 0!< 0`4 0 (   !/,LP -L@p@P@`G=ع -LP`@} -LP`@ 0-LP@0 -L@`Px x1Tx 0-S@L@%`i0p0S S 0S/@PP0 8 1@0괞070@7dǁ -LP@`;h0p0S S 0S/@ 0S@070@7B1@ǁ 0-@PplDML!1(p 000,$@ @@ @P`1 0!0(p 0040,$@ @@ @P`00 400!h0(pdp0`0 00080,$@ p @`00 (Ko[^>_F^ -LM`@  $ pP 0PSq R R x 0Rt $0R7/@K -LM0S0SP0!0@PSR \ d 0  $( ,0 K0 l]@E -LMS`pP( b!@ $ Kp R`0 KKW` wVd (0"O0S  #RH L0S0P  d@0H  0CS00S 00C0000T7`$ 0`K(0 0(00000q0 0( )040#40 Rx R00|0P8 00`$KSESI 0 #RH L R !   @P ` 0 ($ Q*$ , "$  $!$ "$  04(0DSʘ000 0T`00 塇,奇(`T `H* -PL@p`U1! #00S) S' 0S&0S%07070 U@  hx5R 9@8@X W 1@/@@ǁx p-L Ma0SP@ 0RPd0C50/ P0  K 0P Rd  ++d KpS 8P P0S K0P d Q  0Sd00K0! 0  0`( "4`#/<08 SD @R C0BP// -0L48 40 8 00 4 8 4 0 8 00 $ 4"40#4 00$4"40#40 -LM K}Q Kh - RL \`"0 @ 000S  , T0,  B F 00C0P 0!P R   El]]F 0-@LP 10B;@0:FP0K0hE -@`LDMpVX(KP0U U X PXU0CS|IFIFKF@KFIFIFJFU  0 ;S0^0K0]0K%[4"40H`U 0 ;S0@000Sk10 0#2S S . (\K! .\Kk!\0K4k .\K~ U0 0P P 0 ;S0<00l1d00p1U 0 ;S800S0 <00 ꈲ^^ -X`P𝤀0 !`!800 (  , !,LP 0!< 0`4 0 (   !/,LP 0-LM 00 00  合 K迲^芀 0-LP@0芀 0-LP@墋K0h芀 -LpPᥚPPRAẚ7/`po;`1, 0 00S S S,ᣚR00!@` ` $8 (#<4 ̂ 8 #8  ,(!( 0`#8Sʬ S 3 00S 0 KPY Y`1, 0 00S S 0@ (00S 0 oؚ 0-L@ $00CS R  edd  B BM00C00@0CT<ɲ^ -LaL@Pᜄ#堄T!R@ 11c R T!X!S0cB1C0S0X100S 00S 0 T1R0`2S *0g6Pb0T!L1;X1PYO1 C10UP1SP50S00002T11X1| 0-@ML 0X00P0@@ \8040Q K0C 0@0۲^؋ -LMlR@0Sllm0S SX 0 (68!#'( "`01`qV\`e  4  0̑\ÈL 0L ; v00;W10S1  0A0 0v"̀000@0@00000à @@P@@ƃ4(Ko$(68!#t  " "1\:< 00 80 塃  0 夃 80<R@ ~! R00R !\  0  -LP`ATAKhp@ -L M0pS`P S1 0<0 @H1!@$080#0 00 IVภ 00 PU `00 S lYTP STP (K0@4 H1!$00#0#100 P -LM`p@x( KP`Pq$K 04 8 < 0CS0@N @@ -LM@p`K( KPs@PD$K048 0S; +R0;4`彂 I -LMm0PS S /TP 5<@0 ` R_0Z 7=(p 0p`0@00UM  QM0 06@0#4080#40v 40 8 0k 4 0 8 00 0X Y040#4000;#40;000S K; 0    ;0 00 H00 01 0(( 0 040+00"2- 404 14!0CS& 0#@0 04 %΀L 04 L m04 S000 SM 4 &΀L 04 Lm0SM Sg m00@pS S ``0 0tL L006(@p*0#4+08(0#4)0N0S00 00`2 h0@d u Hx048<:#0##<000 H8 #<4 0#40 0H  (41 (0000 H8 #<4 p#400p00   0H k 0p0`00000y 00S;W   '(KPPH|0W  0 0 $0 40 0 Km0S SL  弒Hl]^Зԗ^ -@\aLuEA;8Q # @`p 0 @ o@Q#; S# p0p0p200P!W* " *;0;S,Kow Ҁ @`p 0 @ӀP 0ع؋ -LX0$S0!0 CR01 1x0 `p`!@}g00 04 8 < 00|e= p0Y00 04 8 < 00dع -LMP0p0H2 @L T 3K 0S00x1 0;0000 0fP(KxA 0S$ -K@`P' `C~!΀ L 0 L~Z P d븠0d0P~+`pk)`pi~P @P2TZ ? H= l6I 2IkḠ 04 8 <00S[ Sc 00; m1L" RX X0100Ch00d0x1= S;0;x1`0`S00 0[201 0 SQ=x1  X10S;0; 0 810S;0;H20LXPP(~+`pk)`pi~H?0 `h0 `00 00H`VnC}! `p`Ld؋\ -LGMp_H0[0 H0K}.`pn} KH0 50`0S@%0%*0K  P 0 Q@%*h.@T } `p`}(K IP@0@ `0#2S S7 00S  04 8  P0 $"44 8#8C0 1 00 01 0#21Z0 00 R0S> G} `p`J} 04 8 < 04 8 < 04 8 < 04 8 < 0S (0 C048  0 1 00 (0 RJJ 00 R@0 0K  vPc 0  QX@@TY 00C1 0 1 1 S  0S,;P  0P00 "  Q 0 P 00 ~0P1 MP P0S S pp %1 1 l0K 00 $400 48 < e0P0 Hp[p H0[pb p긊|΀ L 0 L|0 4$ 8P  0SWH0[0zo|΀  0 p|91S" 00SVpKU  K 04 p$#4$!$8(,"( #8 KV 9  P 00 K !fKfl0K p00$K400K2opPH0[Ј|΀ L 0 L| 0$4Kop 4 $K00 00 l0K 0000$400npP00 OH[4 H0[ w{΀  0 {\71S 00SV`K .s .Ks 04 `$#4$!$8(#8"(  Kk {΀ L 0 L{ 0$x1opP  0SV  0R:0P(UI ;S  04  ! h!2W0  h 60S P 00 0 e100 1  KE KE0S S 00S 000   KK10S . 4[. $KWxWP(H0[P  0@` P4 8 <`FVP 0#0##<00 `F4SP0C0ą#40ą"PœpĕpĕZ0RPS|P{ @`p 0 @ ` 0 z `p 0J4 8 < 0#0##<004V`C`ĵ&d`ĵ Pţ ĥ ĥZ; z @`p 0 @z` 00 04 8 `<0S  04 8 <@ Ssz΀ L 0 L  0 zp0`< d0h0l@00`FV:ڌrz΀ L 0 Lz{zz  04 8 <@ 0CS<0S0 04 8 <@ S&]z΀  0 f]z  7p P  04 8 <@ S(406 |W 00 04 8 <0 04 8 < 000 lKK90 P0P0P 0 4 8 < 00 0^ ^茀^W^J^ܚ،H?0!S0 C0P0 o 00 3S0H L0SP0\ 0]/0P0 W ! 0\0<   0CS00S0 0001 qD9!~ K|KjD 0yK4 L0S p0P0 0S60S0 pPᫍ0  00 04 8 < 0 0 ᑍP 0  00<   CoP Gw @`p`@w Io0K000!0 P$ w&΀ L 0 L87P80 G7|1 0( $! ,1 $!(1Qw RtZr 0$1(1 04 8 <18w `p 0 .`p 0./ ` 0/P9wnK90S1  0S !+!  D@!S%0CS"0aQ* S*0S0!1 0D1@11  aK dK00S @!1S  P1;10  + C  001 0$1 B$!010C?S 1 0D1@11S S" 1S 0lP 00CS@;p00CL S!l048<pBWl!R 0#$0 #(#< 0 0pG4S0 0C"0Ó0 0 ƒ0ą#4 0ĕ0Z*0'000 0|00v΀ L 0 L  0 v p01 0 48J 101  04 8 <0#$0 #(#< 0 04W0pCpĵ 0ã0 0'tpĵ0ĥ0ĥ1 ;ZS<Pv @`p 0 @v^000  04 8 <! CRO4!0CSK000  0S& ="1S 0S' 04 8 <!0 BR!1 BR150@ h>0S 0ln80Fv%΀ L 0 LGv 0[4 8 <,10$1010000 ;81?`0S x哼P$?`W YP@?`D  R 1R8!8150S0;% ?v!`p 0!L?v0`0`Sk1h1j1i1 J 0!JL1S .A: 04 8 <0#$0 #(#< 0 a V*`Jf ~0 00 u΀ L 0 L  0 u 04 8 <0C1 04 8 <(10 0!48<BQsR 0 !4 8 <BQfR1 Sh:0  0 +R RR Ӵ 00S0  00 Z0 ;S SS`vI 04 8 <$!S0S;S KI$1p| 0$1 @?u. 0./  0/:uI1@ r gTI#I ;SS SS000$10$1;0CSp꼛FěFpFěFěFxFF0 04 8 <CP40CS(t A`p 0 A ` 0  `p 0 t0 48 0 000C0S6 40  04 8 <$!S[( t΀ L 0 L 0  t001 0p !t0x0|$10pG 0S0 [ڈ9t΀ L 0 L`9t0ZL9xt΀  0 9xt0 ; S 04 8 <$!0CSPq 1S 04 8 <$!Sw000p8Bt `p 0 H8Bt0 c0J0 00 0S  04 8 ,x1BQ 0C  0C  0CS70p10l10  04 8 <$!S+ R02 4'%=0#000 .  04 8 <$!R00 04 8 <0C000s `6040F;s!`pas00y;S5  S 0 4 8 0ASZ100#S 1 Ss @`p 0 @s3P 0 4 80Q: 0; 04 8 <  BRS4!0CSOD5ws!`p 0! 5xs:0`0`Sk1h1j1i1~G 0G 04 8 <0C1 $;P 08C8S; 0  1 0C0CS103/P;S81,081Z 048<$S{ `100CSvG103/ 0`sd 0h 0l410FS s΀  0 s*0`Fr̀ L 0 L 0 r0SC 0L!4 R8 < P0CSڨ2A, 04 8 <4!SFS2p1 03/F \VF10C100 F   04 8 <0CS) 1Va 04 8 3K 1 0K4 3K( 4K20 ~Q 048 '0`0@S410@Sʲ0TT#T1X%XS%!0P900D48ᑻs l]F@E -0`L@(]1@($Kk]荀 -8L@(`p]1@`p`($Kk]荀 0-\@LkFL 04008 000K$0$K0h"ع؜ -L M@R0p  0$K`P  ' P$ 10S J0CS1) N3K08 [3K0 (B0080K7@K01( Ư'0Q1;08C8 S; 0;K]$O]Y?Q<j;]%?]T!X1 L1\!C1S01P0!01S00010 1S ;S](]0S010S01;S P ɯP JNT!X11X10T1014110L1;S0;0103/`عFl] -@aL50P  $Kko8P ;` S HT X1\ B R*1C1S014cR :\'\<\%\0000ع -LM@Q0p  $Kk#``P DQx\&|\+R90S(0Q(0R  Ӳ11' 1S H  B0R"*V\&Z\0 0 B $!  t01 L01 3\'7\<Uع -@PL0p  Kh蹯`P 01; S !R H0H00CR :401 {Fع 0-t@L0S000S=0 0S0 00S000S=00S00 0 0-(@L$0 K0h2؜HF 0-@\PL0==09#9S K0hOP 000 ع 0-@L)8'`%K0h!/ -`@QL .1`pP01P+0B8#8S1 ; S!R0?0$KkR  0?!0!!꼻 -LMP00`Kp0` @0 &0K\0 0L0 0`@ 0 0 000 0?oP20S  R0 (K -LM2 3p1@4` PW V 2 p02 0 S Kqb @DT0V2 00 P2 00@$3S@b T V2"2<02凮)0SPP(0 1oP -K;%2唂 2 2S SO 2"R00W0S -KeP @2\ (K( 0  02 d02 12 2 S0+0|" x2 2( S 0B R 2 R " R  pR t" ( ?KhR t0l" P dKc"K`2 \K[!K&W?K x0X1 ( 0  02 h02 12 2 S0+0|" x2 2( S 0B R 2 R " R pR ?Kt" ( hR  嗟K\l"  d"K&cK$d0`2 x0x0[K\1K&W?KUK d0X1 0k2 =2 2 =C2 0Gsp @:ع -L M    0L K 0-LMPQ@ LP >k 0K#R # eP K000 -LM $ 0 孭P (0S W PU !  P -n@P5K Kh@ -LIM`!Yp V @(K0S\@ R @00S!IoQ㪢 0S0R@ ,1 001  00!,@,,R \ R81 K_K, oc@P+![81R0[SSl Sy,1[S0[S$1 S QqC RQq8 嶧@PKⱧ@P\媬 @@8IKD00KSLP (0S !Y`V !@` m@P5S @@S0  1S01s00R R@t@@SR3CK1C,1[SK0_8 (@j+@>ع -pLMP`K` @#00, K0d0"0@\ 0 0` 000 0?oP2@@T`V P0 V 4`00  W(K꼻ع -LMpP`K` 0@0 n#0K\0 0@` 0 0 000 0V?oP2@@T 0S0 P߫(KPع -LMpP`K` 000@0 6#0K\0 0@` 0 0 000 0?oP2@@T 0S0 P0妫(Kع -@ pLM`KPK L` " 0P 0   0  \` Lp 0PoU@@T <PP ,pjVP妫(K耝ع \ \ //W= 0- \ML@P`!0p,(`00 0P$@ @@ @ 0,p!0(`0 4P$@ @@ @P? 00'4!4?,p00(?(`0 08P$@ @ 0Ο!>,p40(` 00 8P$@@ @ 0 00!>4,p0(`00 8P$@@ @L> 00!<>,p4`00>0(`00 8P$@ @}040= 00!=,p0(`00 8P$@@ @f"040= 00!=,p0(`00 8P$@@ @OT= 00!@=4,p0(`00 8P$@@ @8= 00!<,p40(`00 8P$@@ @"040< 00!<,p0(`00 8P$@ @  040T< 00!D<,p0(`00 8P$@@ @ 0 !;DK4,p0(`00 8P$@ @@ @0 400!;8K,p0(`00 8P$@ @@ @0(0@; 00!(;08 K0,P$@@ @0 (00 !:0:$8 K00,P @ @ 040: 00!$:,p00:(`0 08P$@ @~T: 00 !9,p400:0(`00 8P$@ @f0409 00!9,p0(`00 8P$@@ @O0409 00!9,p0(`00 8P$@@ @8040L9 00!<9,p0(`00 8P$@@ @!0408 00ȟ!8,p0(`00 8P$@ @ 0408 00ȟ!8,p0(`00 8P$@ @040L8 00,ȟ!88,p0(`00 8P$@ @0 400!7,p00 <(`0 08P$@ @@ @0407 00!7,p0(`00 8P$@@ @040H7 00!87,p0(`00 8P$@@ @0406 00!6,p0(`00 8P$@@ @}0406 00!6,p0(`00 8P$@ @e0 400!46,p0(`$`0 08P @ @N0405 00!5,p0(`00 8P$@@ @70405 00!5,p00x5(`00 8P$@ @040@5 00ğ!,5,p0(`00 8P$@ @0404 00!4,p0(`00 8P$@@ @0404 00!4,p0(`00 8P$@@ @040@4 00!04,p0(`00 8P$@@ @0403 00!3,p0(`00 8P$@@ @0403 00!3,p0(`00 8P$@@ @040D3 00!43,p0(`00 8P$@@ @{0 400!2,p0(`0<0K 8P$@ @@ @c0(02 00!B0< K,P$@@ @P0(0L2 00!<2< K00,P$@@ @<0 802 004p,p!B0(`D0K  0p00S S Q K 0'@ ,E@P,0( xQ|Q0s0 00 -` LM$0K0 ,  #0K, Kp@PdP0P 6SU  0-@,P\ QT  ,#F@PI,0( QQ0s0 00(@( 0S@ 010j1 SQBA{O `p`O0(;0`1 (@((111114110@ ឥ@P  K GE@PT0P ,P EG7@0j1\ -L@pb 00`V V /P0S 0S 1V;10;0 V DPPPU P*1`01F0PP  PPPU1`0117P`aP1`01P[10 1Sx !P -LAM0,1 0  (1 ` Vp,1 V@  TTR`@_oQRPU 6P(KS V V   ἾP  dfQ@T@Zx ZP(1`CV((GX(G(G+G(G8)G)GGK XPP1S0000GK LPP1SP+S; K .PP aV 2SVa K PP aV 2=Va K PP aV <2*Va K PP~ aV 1Va(1`CVj*G *Gx+G+G+G+G+G+G(*G001  GKR; FKg ;1K= S01K 1[01K`0`S1[i01Kh1021K1[\01K0 00 H0C0 T11>0 X1 1?0 <180 X  T  1 Q 0 $1Q FK0 10 20 0 1K20 20 111*P ;S 0S (P  0T;/ 000S; S !R 00?0  S0S 0S P00 # P ,00  P @꼻 0-0LPS(@@T(@;SK0h1 QK0hY1@P 0 0-LM0K K   # K2@PWP nK0 -LM0K K   # KP?@WK p-LM0K(K( $  #$ K`@P (P =P  Y@9Kp -LMQ0 ` (K 0S S1p11@11p11@1P0K` 0 0, Kd" 0 0\ 00 000 0e0P?o20S0S* BRX0G|0G/G/G/G/G0G0G/G/G/G/G/G/G/G/G/G/GX0G|0G0G0G S  SX SS0 0S  CjQP1P#US  ӖCjQ@1@#Tꠛؖ ( -$LR  KhLo_^ȵ^͵^ 0-@\81LP01P34110#`pc(>l K1M  ,$ 0!< 0`4 0 (   !/,LP -L@jp@P@`ߑ!᳅}ع$ -L@PO`101Õ t0 ђx -LP`7@? -LP`)@F 0-LP@W0 -L`p@ P_@} -LPp@ `ᇔPPh1S/%;8cG 0-@P`pDML!20 00p,P(`$@ @@ @ 0!x20 04p0,P(`$@ @@ @44 0 00'!2 008p0,P(`$@@ @P 0 0 0!1 008p4P0,P(`$@@ @P0400 0 0!p1 008p0,P(`$@@ @P 0!(1 00 8p4`0,P(`$@@ @P0400 00!0 0008p00,P(`$@ @r 0!x08p40l00,P0(`$@ @ @0 \(Ko6^^8^^^ر^$F^PcGM_-\0 \  Ĝ     -LlMD `(= (=0SP *d0K |P  d0 QP%P *\NU (< `p`(<(K 婯P P 0 4 p $t"$x'xW (<!`pa(<Pd04!48#8S A垫0 4Jp! 0 K4 8KᴨKz|p xp  0pK4 7KᴧKop0lp hp 0S㈐6  p܃pP/7[([p0p0MP(<# 0(#<'[p\噐P 0 0R:(0 K p  P spPUGPl 0XP H0K ˰P\ H0 QP%P N:UP 00WSu bK\K ⴆK'& 04FK 6K@K⸄K& 0dK`44KH K0KrpT0(P\* <"`pbG0S&7[Rt0S p Sx0S S &8[R (0 K (0p1 P ;"`pb(; P0JP $^ 0-LM0S'0S$P"0!0@S P% R \0 Q@ 1 40 04 H8 <$ɍK0(0 0 l]PfG$@E -L M 0p0P@xX` X /@0S  ៫@ K0S  @SW @0dS*@(KPA@P(0S Sd0<d0XW 1(`phE4"`pb46P 0 p0 @00 0`%S0 x0 p00  $_- V (Rx0 0C p 04 8 <00 4000000P0 0X00\00l00d0S0 0 XR0S Q   X BR$-S X\   BR 0 0   #0 `00D00D00V RP @@  V} $X0 ,X00 H 8#<40#400 X0  ( H@X삟vX0  .00000C0<08 8 80< L< D 0`0C0,00C00Vt(0 9 0R0% *L0K JPP L0 Q:Q a@3&3W 1(`ph`}Nt0Ph0y R |D5 `0q    R X0 uM$_, @X0i ᇤP<08 L8 80< < D 00C0G,00C0R qv `0H0p SX0S(0I@000@0SX 0\ r0S,0  ^+  -L0K M#) @j0PK -`PL儆傆@@Tp"p@ 0RD0S崆,Ko谆00C08@<00S 3" 0"3< T2#2Dع+ 0 / d-LΆPT@`@0S8$Kkt0P2"2@+ 0-4@4PL0S 00K0hTع 0`( "4`#/P/&HP/ -LM40@ R  K 000 קK -LM40@ R  K 000 ТK%0 -pLM@K`P…` /0K\0 0 0 0P@ 0 0000 0?oP2PPU@ @T@hp@`V Tၣ<؅(Kw@T %@@+\ -L M    0 備 KH 0-LP@iGᎃPPG01M/ ~-Q @  e -0L 岟o谛`P 0-ASLPH S S9 1B 1SP S1B "`pb1Q\G|GGGЛG1A `p`"1A !`pa1A !`pa1A "`pb1A "`pb1A #`pcKh1Q Q1B `p`|1B @`p`@Q Q Qo1B `p`h1B !`paa1B !`paH -PLM'U@ d50S X5X%X0T50(000C~(U \0K( ݟ(E0/S0㛣@P ( \K(0P 0 :00)0K0 (` Zsp4嘠Kp 0 ( Kp q ppp0K K*pKߢW0000`00:0\K0 pP13\K0000<0,p( (0C:*p+p)* +0<00K0pp0 LP Q% 1)@PIQ 1(@PVH ZV KVn V 1+@PK0/S|0@Px(K@7pP 0  h2尠KTK\0 0KXp Dp E\KYPp 0` Pp EW}b20S2 .\K(p\0K!B'V9 ?V1+@PKVP V1E =-@PMVQ I:V1/@PO1)@P0IS1*@PJ1*@PJ1,@PL1,@PL{1/@POt0<@P@m0>C@P@Cf1-@PM_1.@PNX1.@PNQ؜n]۶^^-^ -LOM(P( PEK_0P,1  1O `pU`/ `p`/,11 @P@K,0'S ('P (10<1 K ('P 1 Qp%p * 6AW  <]P(1p 0(!: 0PH1  =0S PK .`'H1Pt-0p0Av/ @`p`@m/B  0 k/`V OV 3V V <0S K . `' .\K\',1,20\0K00}A0SpNV V,11"`pYb :YpwVV:U,1V1 '@PG ~@P( 5SFV Vg O:V{ V,11&`pYfx'U _@P( V :0FSK,@0`0 0K0 ( ؞P !00Q:00S O* `p`R*K,(KP`041 ,V0} AVC +Va 0a 0X@(1 K28K4KHK @P  tPHK b$K_@K⑔@P 400D K  0 @K?P ၔdTx@T 03/@DXP XpD@Bx [p}xWT 40 %0&pSR000S H0! R 0QP \ 0S\  0WV*H$B̀# 0#$f\@+GH -LDMp50SG 4H@KH0 0P0  HKD 0 @QP6 0S3 @P0ݒPP+ 0 @@ 3SH0L RP\0 0@ P01<#P0 90P  00P0S9@ \P9ဖX |`T 90`TV 400 0S 00S` `` @0 :  000  T0  v T0( )0,0-0.0/040 V  0 @  yPPPp 90P  `T0 `0X0 P0SnX)`G`(`0 P0V`C`V(0FSq*FAῒ <0a0`ppG(pp(0p(pϓ`ss0s@s(0:( C8*`#<4+`8#(#<04 8( #8 * +0``` ?PC YC 1)@PI1(@PH1/@PO0` 0U }6 0P01Q0R09 F0T 9 F Bpz0q0cRQ aH(``X ᙕY0@T#F `p`W#(K$H 0-L M@:T0 p@PP P@  R 4K@P 4KK0 RQ@ *@ -0`L@#1@$Kk#H01,!,"/0!,21 ,/@-, @ . @@,@   P/n 0-@LP 0000D 0-@PLᕥK0h3 0-P 0L#$#"$#"4#  B0 AT06 P @ 0-L@PP j0 0-L@P ^00 -@LP` <0400 00 0Wq@P  4 o]º^ -LiMp P P H1[S  CKP vEKhq 0 D8Ѐ 0-q 0 8Ѐ 0.d0 <Q00 00 i?iku(ijuP iNi0iil^Pi Ji(eiHi%i i i i ߖ>Si Ii !i Ti J@J[ -`L Mp*fPLBp0 TD@DT UJL2SD0C0@! ; R  R`H@T D@Df00PUP y`YP$QPQ P H0S D0CSUVPP(KUP \P -LHM<0PS 3A0AS`-LBT @q@D@DT  $-$Wך$K00S0hKc -0 000S(nP$ 00000S ` .TKT0K )0 00%mR,hKfcH@T D@D0\꼻,؜o]޼^ 0-@LlK0h -LHMP!CW y3`,LBT p쀟D@DT  ,,1S 000$K00S!hKc ,$S00S ` .TK$T0K TK)0000g,hKcH@T D@D,؜o]^ 0-@L1K0hwvQ* -LH, 10S@?CP4$KkZ,!R* 'd R QR :X UXYT*R QR@1:@T QT:@@2S ?CS $,T0@ǁ -PL` @P@ P @ -8L Q Q Q Q La'0AS@GQ #Q 5QQ Q Q^ -L``P__?d0 00 su0@0L0`0D00@0 0<0(080,040D00040,000u@GGGG,GG4GTG -L`@u0DP0inBi__ cKh_ع0008C0 04 8 < 0/  0-@PL_!>00000#800 0-@P LM@000000 08C0 04 8 <00 -L$M@0K0KK 0-@L__Py_P0 -@L M0QP`E 'Rh 'RX8'("($xpt <Ke<K,K0 Sp*00S-0  0 0 0 0 1 0 S00S"1000000 Kh%S000CS0pS000CS1 5^a^ 0-LM`@P K0 0 ^P1K Kp|X |K|K K|K|KK0 K0 00K;PpW> 10S !M' q* K !P0S P W*0@T BODT h  P@ AT `*T K$K00 00 @p]؜Lp]^Hp]d -LP)*LbV@p D0F`@Sp9*W @Op/o"\ R\ Q0! (^ R@R@ ` H0S D0C80GS SVT#SB (S S0F0 8P  $P V D@0@$@@@  P GS S %SV000 00 00 00 00 00000V0S  000000GS S~`t| QRp-LMP`0=0 CP.P R C?RK KW0[ K0 C0K@T'X tKqtKֽ KtK [KtK޽tKK `X0 0<00K0 b`KpA DR @@Õ -LM8@Q :0AS 1 0 001 000$Kp$dSR 40S $0%Q Q 3  h40S 0X$\1 0 0; K0h>(G -L M@1p`0.P,K ,0 (0 yP T &0    T  ,Kbo@` K@, ,0,0$ 0C 0C l 0-(@L| K0hlH -L M⌀pe0,0 (0 n'pl0@T' KieODT 1 P,K.`P  &@Bعǁ -L$M0,00(@ S( G@P 0<S?@P 0 0 ` Pd%R Qh 0D0 40l 00 łpP 0H0" 00P8#<40#40e8%#$0e$"SH 00S 00 0 0 0 0 0 00Q7Q 00̌p"(0#8S!0S  R rh0 `20S+  NK-!> LK5KL00S PKXP1` R S 0S0S0S h0sXP 0x0V `P0x@ K4o] -LM00 0 0@Sp P(K0S0S/P0S" 0S(01S x40Soo`bWPP 0S 0S0sh0 x0S|0S0S0S080s x0S|0S0s K3!,2q1,2800 x0S 0KؠK0帀Kx0 080 KPQ`V KXP Z |0S0sX K^!>8K0l`K80 (0K!0K0`0pWP0S100 fPd0 K;KȀ Ā 尌K TȠKQx fKwCZLx0,*[S |0S0S0S 0 x0lK`KPcH0[`x0S|0S 0sS0SQF x:[60S (0K 00Lx0K0 K8KP +d 00d000SP {0`( "4`#d0 dZY0S100 sw =P P1P0P -0L@S`(P`pt0S    0R, 00! P \zP Q8y#y^_0Khg[ع  0-@Ld06:d 00d0(010K0h -LM0@SP0S0s  0$ K0"4Kk_40K!q$KP:`01 ^pR WUOQL`JW"^pWUQ`\p`5PU P@T*0P050A%@Q Qp`pRQ'"0Y$ R Qp ! Y0W pRP'p5 W0YpRPpp5\0YP: 0Ypp pRppp꧿^t] p-LYXQC- P0HQR  @PD<p`,X \00R0S P 0S @@YS  00 -L,MPQpP0 ` Y 0S@/PH0K x@P\ 4KH 3PF P P0@(K0S1 0S.0s+HKL0K HKx@PIUA; 0S$  RT H0R S``V 1% 0%lxHK000 AZ V H0S 1%`peQxax@8PAz)`pi~U -LM7!,2 p1 ,20lKP00| HP S0 0 0S\0K 0Z$ 0S! P X`P`H0K`| K APP H0  WH0XH `40P@ 3PAP|Hw0\ 0B?o20S X`PP 0S 0`Z\ @TY 0S0S0S 0SM  FKd@6@pKV4KXHKTP-n1PL0S VP tPP YWH0 L0 `|[ TPP 0S FWp5!,210#,2(KPP0`S`4W 0S0S0S 0S PV KTPP0 0 4@TBOD@00 0 刀 匀 ps p KlK wTPhp0 RdHK`03 PD0S@0S<0SR t KHK[TPLx K HKUTPFt x0RB0?30S q 3 *K 0 BQ0:`0 lK0 cPp`pW 0SlK) 0 )@V 0  0 0 0lKp KHlKp t QP HeQp00t0 4 |V0 t K|lKQPt p0R0 HKt K|HKp t PP H)0 4  0p> 08P00,($@@ @p`#8> 00!(> 008P4p0,($@@ @= 00!=4 008P0,($@@ @ 040= 00!= 008P0,($@@ @ 040D= 00!4= 008P0,($@@ @̧+040< 00!< 008P0,($@@ @ᶧ,040< 00!< 0<08P00,($@@ @pឧ 040L< 00!<< 008P0,($@@ @ሧ040; 00!; 008P0,($@@ @r040; 00!; 008P0,($@@ @\d; 00!P;4 008P0,($@@ @F040 ; 00!: 008P0,($@@ @0040: 00!: 008P0,($@@ @040l: 00!\:0<0 08P0,($@@ @040: 00!: 008P0,($@@ @0409 00!9 008P0,($@@ @զx9 00!h9 008P40,($@@ @040$9 00ɟ!9 008P0,($@ @ᩦ0408 00ȟ!8 008P0,($@ @ᒦ0408 00`ȟ!l8 008P0,($@ @{040,8 00ȟ!8 008P0,($@ @d#0407 00!7 008P0,($@@ @N&0 400!|70t7 0<08P00,($@ @ @5040,7 00!7 008P0,($@@ @0406 00!6 008P0,($@@ @ 0 400!6 0x608P00,($@ @ @040<6 00!,6 008P0,($@@ @ݥ5 00!5 008P40,($@@ @ȥ0 400!505 008P0,($@ @ @ᯥ'040D5 00!45 008P0,($@@ @ᙥ0404 00!4 008P0,($@@ @ქ0 400!40K00 8P0,($@ @@ @j0 (00!,40K0 4 $00,P @ @R0 (00!30K$03 00,P @ @`;0 (00!3@@030 K0,P0$@ @ @'040P3 00!@3 008P0,($@@ @0403 00!2 008P0,($@@ @0402 00!2 008P0,($@@ @040`2 00!P2 008P0,($@@ @Ϥ gPD!0@C!00@ T!A0^w  Mb1AKJ~%E1bMa|np1(K͵^O^$:^ E^^S^S^ț`^p^؛^^^^^^^^^^^.G^^^^^(RH ^ ^$^^H4^?^ J^^HM_S^c^^G^G ^G^n^^^ܛ^^p].(`H+ + R RR CAQ ,0w -0L@0SP S S `(0 PH`(00S 0  #n -LM<0 P<0p0D 8 )S0(040K (HpP 4 0Q0%0 *X S B `p`.0 0⃑(0R`%(`" *00K ("pP 00 Q``V `@ 0@0 I R :R R> Y *  Brp(KY A~!`pamY R +0 0C D04 K 3 K[$!$("( IY@<0@  80PYpW   B( 0 (D*0 0K0 0b"!b! 0 R (( 0(),0\0Q H8 ؈ 0(,00C8 ^ -L$Mp(0P@ ` @00`SMh0  @K@K>J2. 00 )0@K⺏P@h0 0,K/ 0 )0㭏P@h0  0,K4 8 <0!c#!$c4"#:0 = )0㔏P@h0$ 0 R (`P |A `p`(K00Q l)01 nP@lh0 (0+Z Z `P 3Z0H0 S 3Z <Z+Z Z l3Z <Zh0)02  H0lh0 )03 )P@ -RL$Mp 0DK(@(0 DKHP)0, DK `P P0 ɋPbl K1M  ᢊ -(QLM`P 'Qtt 0(@pTDK 0K h,W [3W@ p[ s]^ p-L,M`P@PDDz 0 (0S+R8 R5 )R 3R <R- ,R@S:D0K lh4[<SUD0[0 Q'SD0K( \h(U>0[0Kp S:D0K PhUC[D0[0(0S S:D0K >hUC[D0[0s]^ p-PS0`@L MPK0%0PT @@Kp 0-LPl@P  h@P h 0l -LP 0-L@lP0K0hh (0-LM0 0 0 @ 央0  R 6 @`p`@/' `p` RE @: $<>0F `p`#T 1 `p` `p`0& =(   kP #!`paT 1 @P@(K2S# # 0'S(Dk00`S )`piTe 1 @P@^0SK  04 8 < $ ( ,! $" (# ,%$ $& (' ,+  $ ( , ČȌ̜ČȌ̌| SČȌ̜B! Č"Ȍ#̌|p*`pjtT 1"@PBjrP 0'S(jP W 0 P\Kp K `p`L0( KqjP0PpGP 2*@PJ6~G PG PG0P0  :00 0S-T 1)`piP9`Vp@ `O+ 0+$ 0$T` 1#@PCP9K0 00 0 0 K0Ki0`Si ΀  0 V 400SH080SL0 0;00R 00 p0S# KP  zP 'P 0 FP * 0* 0 ̧$4"48#80 XĀ 0K KKKP~ T 1#@PC9i,g2̀ L 0 L 04 8 < 04 8 < 04 8 < 04 8 <  ZK6 TK5K  \KF   0Swh60S  .\@KK5 .1@0K0&0W h660Spp  $ 0$ T@ `J`000jP0 4#0S XU( 0(T 1# 0#1 @P@0 %^0)S(0\0K (?kP \ 0Q0%0 *O D  0 >S 00 0s \40Sp0(( AR*T  0 Tu 1#@PCn(0Q Q0(0 Cce0Sa30S P dC;hsg$`pd3WG 0 S0  $ ( ,  $(, $(,r  $(,0 $(,(! $"#0(<s(* 0**T 1"@PBWg06% 0 % 0S 1$ 0$V g`pᄡ儑0S  S  `p` 0( 0R `p`Tg 1#@PC`0+SW T 1 `p`(`ph0,SV`p, 0K0咑#  0K3/L0 PS CǁH+Ĝ؜(s]^$^p]R" $ ( , $ ( , $ ( ,$S 04 8 <! 04" 8# <% $04& 8' <40 ;0\K0 KZP @ @@P@@CKR -LM@pH[PPHK0KG`P]g100 0KF0KFع+ -0`L@1@$Kk -L M    0Z\ K -L M@ ;H0 0S@ T0 Q00A;00(KogH`娀aPU pW x0S 0CSx0040 fr>40pS 0#00C000d>`عHP -@PPL `0 *P M  <f\ `P/0 !`8 0 0 (  , !/,LP 0!< 0`4 0 (   !/,LP -L$MP0S4@s0S/ `08K< @0 0( @ KK@ ሾ0C(@DS0 K P0R H@00@ R0C8#8꼜4o]2ix -LtM7P 0 P73 R ǟQ"`p0b'`p0Pg@(K`70S 7S @@@0( 2hPPI 0'S 0 3SH0L0S(!fPP7 00dS lS3 e@0`p000* \ ( Q# FK0 X&0$K 0dR lR 0H KP%7@<`p000@Kp겠`@K( "KR6`pbhK`p0&0&K0 hK&  XKx K hK1B@Pt K XK+B@P; T0*`pj4M`pbhK`p: 1<02 8P#8sQ ##&3#p KhKAP t*@8#(Ql KXKAPx p0Rt l0R"`pb#hK`p0 #3^ H(p# 0#/aP #0 00(00hP d01 3S4H0L R0P0AaW eP (p(pph2Dp @KH0 0,0p 0LrH ᲀ 2H K P%IgpP n0'S 0 3SH0L0S(dpP 0<02SX24K0@!F0K0E0KH0K00*0D H0 @`K 0 P 0' 1$\ Q\:\ Q\:(  \ R! 0 0H0KH00S 0\?d꼜H 0-@p`\DML!0 000,p(`$@ @@ @P 0g!0 0040,p(`$@ @@ @ ߙ 0!h0 0`00080400,p(`$@ @ @Pș80(K͵^ ^HHM_8 0 R kR ~ /-/Ἔ p1-PLPC 3C7CPQ 0@!@0#0#0#$0#(0#,0#00#01Q.pBaB$V V( &#&$'$ uP $oP0S `P0 0S @03#"ku( -L$MLQ@p 8#8R$@(* 傻WG@ᤰAQU.@ T+s 0R =00@@@(K8 #8`V  0@KD H0 x00 H KhbH@`V`:Pc: `꼜x4o]2i -LM0plSP 8h R @8d0CSpH0H0S;  T* K.@KKd K.00$@05[$00KKlK5[P RQ@T 꼜 -L|MP @R 0(K0S000CS B 0 4 8  V6Sx0S|0S0S0S h0R99% 1$V* %V h0R88')V- 'V$ (V| h0R77/VK 9V0 +VpYc h0R1 1h0f0  Rl0VO h0R88h0N h0R77 h0R66 h0R66 h0R33 h0R55 LKuPP* :0LKI!KuPP0 K 0P tPP 0m0 &P`P` U 0PPm 9P`0`0000 0CSDHH\HHH LKtP X`LP|  z8P| j0)3Sc10"|0S20[0S@8 0R;0S8PU50P1LKtP L0  R00 s800 K|tP 0S0ŕL8!,21,20|0 0L K0|Kx0KP  Pzx0St0S p0s ~U |LK7l|Q 3S100 xKk5P`|pV0 KxKM P 00S0  000S xKxP `hK tP oh0S d0S`0s4U aXP|  7P| J |Q $5PI`|VE Yp 0Y ?P| `X\36D`KH L0 5LK4 n4P --0EKsPP0S S Sh04h044h044KsPPî0F;S񟗶HHHHH@H@H@H@H@HHHHHHHHHHHHHHHHHHHHHHxHHHHHHHxHHHHxHHxHxHxHxHHHHHHHxHHHxHxHxH%V+ V4 V" V2 rzV& $V60(V &V 'Vh0C9 +V 9V! )Vh0:h09l00 h08h0C:h0?h0=h07h000h0C;P1xP 9P; 2dP `K8`h0 @L0K hKPP eW0x K@4PWU"2x RLK x0  x000 LK300 0#`Fx0 h0 VHHHHHHHHHHHHHHxHHHHHHHHHHHHTHH(HQ Q LKfLK qQ t0St!KQ8 QQ@Q<Q pQ QQxK xQ 000|0 |KQ|hK V0 V V-PS 0S0L0  zSL000S00$ 7PW00  0-PPL0P @T00 K0h@. QP-LMPp@`$KU0S0S P SP SR#00)Q 0 00000 000B0 p0 B P -L`pY@P00'S(V@PPs3q30 KhE -LUM`T1 @?H! D !@ ,21t ,2D!K3 700 dV@0S0P1 0SP!00P1 0S0P!0P1 0SP1PXp KDPP00D1 pD1 8D(@ 0( CRL1 (0:WKPPDq (0D1 PD1U@`RP77P8Q<Q@Q$pQ  K !tPP K !lPP UUUU0L1  K !ZPP K !RPP0p0P =0 0L1  0Cc#! c),K0!B p(00(0000 D1RJ W= 0 3SH L0SP0\ 0X<ZQP Q  U< 0CS00Sp p   0008#<40#40D!  <  R  W     0Q W < 0Q W +   D!(3JK0 㯭0S0PL1 > 0z4 P8 <& 04 8 < 04 8 < 04 8 <T1 *@PJ-PL @E0S *`pj0-PL1 %HQ0K( H H1V\1 @0tSH0H1 P)0s0S0S8000D1K p80 0 0S. 0R/K0=KKcPP@1KH04@.048L8     R *88b 4b4#0#$0 #(#< 0V 0SK0S K4P@ @X' T1P00T`1 0S 1%@Q $LP Z ,PPLQ K 70L1 KHSPP L L  FK⻬M/K FK0PE褆KK⼀ o0P: 41R6 BK⡬M/K BK0P+KK⠀ V0P! 41R3dUb1S1S1S 1SV  ZK5TK5KF?KX \Km0PD ԀA  TKB?K\K]0oᨂX X2 <50S F/K.\K5%141x00\0Kq&`p 0&sZ 1%`peX1PDSL i0Z@1S 4  Q00H10D!X1 0d1 0Q<0=<T0 1) 0)3ST,)`pi0T 1%`pe3PPl 0S 0Sf X!D0Sl 3i0S00Sb 0\!S@H1S@ 2TKX \0 J?KK?K \K\D SN?KO/KXP @1S \RUy<1 ST1M <<1 %0#00S ( ,0K0 #KKQ/KKP$00 QKFPD1S= R `p`1`!0S R D!.P DR@HhRH0KPuRK 2L1S K 2tr (KV x0S 0SV x0S VT! ( ,0`! <  8!R+S  R8 1`a R 0SR :\ 0S\  0WV,<1$ \K,1 嬪K?K@0 \1\ KK(P^؜ds]^Ĝ<ؚHY 8!R>00LBT D@DTP00SH@P@K) GT`0d0 Y$ >0$0`0 0$ R0 dZ~0P0 S~0P P@K`0 )TK/ 9D`P`0 0,K ,0!0;~0P P$``P+ -LDM2T `!,2P 1,2@ KPP (K0 @Km)PK@P K0P-MU @K[)p@ (0p(  pX0 L$ Ⱗ` :   X0ppp ᢧP0X0 pU` T0pST U @K$) 0 p,( :0a0V D0 02q4K0F0K0000E0KP0  0 V 1( 0 (P0S1  `p```H0K 0?o  2@,_` A`p`A4o]HĜ+ 0-LM@0$PK +P0 (0$0ԭP 00S0(00$0K0 X $000($0@|o] 0-@LLn_(0s 0(0$0SK0h_ +L0 8(M | Ѝ?_+ 0-PTBLT0 vP @ -L0M`@P 0S   1HpK8PK ,+P0 #+P$0S  FP 00S p p00K4p 80  X p 30@P(0@C_᪛q%^K|o]p]2i+ 0-@L 00CS 00K0h 0-P$@L^K0h_+ -LTMP@@KM.`P  0Rp%p *P0K ?PP P0 Qp%p *hOW\C @K$-(K0 R 00S `Km `K*P0S S M3`0S\0SX0ST0S `0[St2PK  i*P@04@D#DJ^HTr$HW 0 x0 P, 00S($0S% `0S\0SX0ST0S  `KfPT 00 0 0$0 00CS 0xp(0s '(10 !#30(0tK-'KЃX SRl8PXQ Z=  X T:0@j0Sgh]`K@P 00 0 0$0CS 0^PM4^H|o]+Mb -0P`L M0Pp]fP @ 00 0 ]$Kh^$@P700 0 00@(0 `  ᠚T20ST28K@0TB00< ( @0 @ Kx2P 0S   I$@X(0$0%+H1i 0-@PL(M]P oK0h]+ -P`0@L9]P]+ 0-@LD(]TP @T00 K0hs]+]+l]+ P-L P $5^ ^^+ -Lp` P#@P700  00PP#@ 0-@L4\00P -]#0+ 0-@p`\DML!0 000,(p$@ @@ @`P0  0!0 000400,(p$@ @ @`0ԁ 0!P0400D0,(p0$@ @ @`0 0(K͵^H^H^01,!,"/0!,21 ,/ P-0L P R  (R P00  -`L,0 0 ؘ0p@T,Ko,ꌀ匐ODT 1PZ 0>CS0 0*00?0)#3 0@BT ODعdHǁ̜MbP/2% p-LM` PL2@S7 P$D0CSU0 8K%[ @K\T8K-  F@'  R@ !R R r ЀHQlrP ЀHQPH0S D0C KpJ,^ -L,M2bRB0 "09&,[ЂXT@ P  pR @0R0 [ |P t2@0S dBCZ P8{[0rP| 8 `r ЀE0XR 0g Q@K UB_E|$ r0 KL0CR)*@T @@ + 9Oo B , p +"P@K ' շ +T@K@  |@$ KL0C\*T ;X R Oo B3 + @ +T@K uT  X(S[T0+(K輻̜عPH,Jd  0-L@hP)P~0(0` R T`@)&r0 -L M@8@0D Q #Q0`p0x WV``h \0S,P   @0 0RKhR S`lKШ@&^ -LM400S S 0  K0 7 KdI -pPLM00 ,00 p vZ2p XZ0(KWq 0H0ZlH tKtK tK &P l K.K KX0X0 d0T0K80P0 <0L0 023K8 r 0 E 1 R0P0 1 0@$Kh0`PS@K80 \0H<0 8U#8H tK3KȠ 0`V0 K0 K %P  . K6 KL^  KP@`0HS 0,̜s^ -L4MP@pppY0XPU2Z(KX+ (0W(:` P00t%P  .\K\ Kh0011\ D0D  \ 022T((@P,^J@J p-LM@!YP XP\ 00000x0x 0 b d PP  TT+L`0D 04 0Kph,]^Hos]^dHPH 0-LP8n=@100%0?0: !#3 0?000t00S 80S3 #00H00S 380S000W00uMb1M 00-P@P LᚠU @@@D@H @P0 -@0L@Sc `Qq@ DR HQ0PP zDX:XQ C @`p`@P i01 0S@00@H00S R   P! R  Q!L 0`S\@A `p` 0S $ 4H0S ̜xs]H6@ ^^E^ -PL@`pƕP 3Px00Cx00Ѐ|0 ?ᓞ 0%x0V0x000 0apg0 $Kk 0'0 JI -L M@0@`10PS:6S7 vWppW! eT!T1ЀX0Ѐ`V p ß" 0 x00Cx0X$K   ?!XvyX{=rXX 0 p0\8K@0 0  0@K0`V0!40 30S  0 0 I0S:8002040 1,0S|10H0 KİpP L1,0S @10H0(0L0S  <K#H0Sf 1`a40 3S0`K00 0 40 0p 0KP0 K#Pd0 0S PK .0P 080)|o]s]^^5^R^̜ǁx^ -SL MpP@*P+ P@% P*@"`U@ (K6/@P(W 0P!P(  6/@P @( K` II -LDM0PQ0``0  0SPVU0#V 000@T Z0 Y1U pWpD0d0 0X (K `叝P dh0 !ᆝPh000 p` .W4pp\Kj\0K 000@~^^ R 0 00 0-@L⥋XK0hP/ 0-p@LM,PKq0e` |0[pSI0V 000  0 \K0=`P .K0K > L`0S"a00S80%S (S S`KP P1t 000 W <qW !(KGS Sc^^ -LQM0` @ K H1 倖H1Kp&PP H1X! t70S @K .H1`K. 00P0,',$GC `p`k 0R|0K  ?P |0 QZFK3c `p`f(K0` d0Kh0l! KAP01[S 60S .K.KR0K%y@0T1 00W00SL1  50S %f| KD|KP \50S P%dUK O=t@T" p@9q 00S 40Sr .K.KpGp90$00K2d Kb P KeLq@C/KKqP! 0 T  p"80K p@}G  CK .K.K K 4K}K0 K zP30S!  .K00#0K KpP 0\1 00P1 6SX1 Doo9 bR`Vd[606T1S* 06%0f @0#010 00P16L1 @FX? 2@ K0 0@ @0 K0J006t2 h20 ?T 6 9 dP00 `  R Z9 X1S 061 10 ?taML1S M" XMVTN Z \1&?oR20S PL@0+ P1 Y (Y`@T5 BODT2 0H HR000hK cUBhK`  AԜ؜dt]d^^ 0-L@P lP0P`00S`0`@K0h -@0LQ0S   `PU 00CS0 , aKh`\^ 0-@L,oAh00CSh0K0hA, -LMP p@ Kވ KWKXdK0KK 8Q  Ph00 0 K`P ,20S`(K " 0T  000 P 0 000 0@T q0' ABODT  K`0 EP0X@L10S @!HS`8 BQ03 !0A 0  S0!@t  B 쀟 @T3!D    BR !40 00 S*H0  0KH0 嶠`PDK@GP Y@00S 4 H11h  h Jxd؜}t]9^`^J^ 0-@Li0PS00S 4K0hvHXI -`QL@ 0aV00SP $PU P R 0 0pWU 00CS0 h Kh5`Pp 0TS   %$Ԝ^ -LM0nK p@P 2 2K0P1 z 101 4Ps 2X" T?0S oOK .F2PK. @1000 /0cO C !`pa#L1[S1[0S >0S  .oKo?K.D"0 R200K s1P 0 Q@8@TN `p`K<(K KEKP =0S - K'/ 0P( T 0X 0K⤀K\2p0U0K0 $4"48-8#89K00 10   =PP10S 1%UL10?0!!#3 0<00 0 00  10S ! S!0… 2. oK⁴0o/K@0100101  =?A}PPs i[VRP`V 0G?o282 0S* ?1 0S  R $( W P@*(;0S 2o_K. :P0*$` R @ A 190 00S :0S .K.oK1@D@90*0o?KAh0[`09[100[_V Rd*0 T`V3`000PP,:0S Sڲ9[S : H:0R ʼIϻC "һv(h`Pq ( 'KPYk`0S 0S ) R (00aQ0S( R (0S S00S 80S  .oK┳o?Kh(K?K0 ߅(~K0 1,1 1[ 031K0![2 001K0 1K048 } 04 8 t2 7@T1S 1[ 7 70RhG:C "=0,!R @ 1[d R;P 1[X  X X00X0Q 1801<0C6 %1[ \0pP x60S  .cKp0&00d00c?K1U`0C1[L !1RHJ1L“0 02 1\DL2 "064 pR  <" !ԥL2  " /K% " &  " "r  H" \4>W1S ,Px1%0 U 0S\5,A0qSp?@PC W R85Z4 T0S00S \0`0SL2SD0C 0S H RD BQ@ Z2 =2ۙ==84 0R,1JK 0 1[d01801<01X0uP d30S .K.cKK0 0,1#00 1[0c?Kj(3d` (%W0$ Q   3 @R 0X0 P 20S .K.K,1"00 1[00K8U "000X0080<000Sl0@2 h 0$2 e1SbW p~0 Ѐ X0^0$2 ʡ0N0<"S 3RPL"S10"R0/K "rJ /KЀ/K" "'  @P#150A00HX #*A sS QH0PQ K K0  /H\ DL2s/K2/K؜t]4^H^^^J6Mb̜^v^^țW^^^Ԝ^ {^9^t]^^^t]^t]B^؜t]^,d0 R" ,  R !d X k 1[K, 2 Y4P  2S  R `0 0K i"Kl0 K2 ?R(1Kp 0 >K0p `  0#00#0 d 00#00#0 h 00#00#0 l 00#00#0 Y1\K`p d0 >K1Lp 40 100 H0@0H0 ,K/P K.WKҰW/K, 78"KᅛP D20S K.WK⼰2"0W?KW/KK)pP h00h0,0A\00\020S  0P " R #WK}~1P1U$ QU:PU:1!0@SE |Ct30S? 2ooK. nP`0#1@000K00';I;v0`00PP000-/-1 010194o]/-/-/ -L M    0~ K 0-@LA*?*-0 -LM`0P 0 h 0@0S(01   0 K&( 0 ~IP(H* P *D@ѷ"`pbշK1M  KH -L嫧 -L帧G 0-@0L@0SyP 㞰00K0h\Ĝ 0-@LH0 -LH -@&K8 \5 ,210#,2(Kp0P00   #RH L0S0P  (&@0H  0C'S00S 0(0C00(00T 0 (0(0(0000 N800 0 00K00K0x00 80P(QpW 4d00#$ #( #,`0 0v00K00 00:S p :P &vpw! 0SM0CSJ:00 0,K:i(p 0 &@P] 0( o K 0 &@PP 0, K0" `   00:S0S `pUhf UN U4 UB PbP1@"U@ FU10 `pkUW ʄU1L D0 `pmUX PU10`po  `pRi10 `pj10 `pk10 `pj10 `pl10 `pl10`po0<`p`0>C`p`C10 `pm10`pn}10`pnv0`kC 0#wT!H p-L$M`1@P R8@ 0 0K08 4 08 K3@KpR 8K70[S/@80[S@ U k%9@ 0-LMQ^@0 QP K ! ?K0P K@P0S)^   i^e^^-kN^\\?  -@MLpH 0000 &`P%`QUʀ 0! `0     !0 0zF`Plᙧ`P $K0@vp0 㓫 |,LP -LM@P` 0R0%0 *(0K &P ( 0Q0%0 *S @k `p`op R  ! $K8`U(Y0 ᣋ^@ |0 0-@L@" " 0 -1LpS` PU @1S !S T"S TP11@T-1S \  0-0L@S00S S0S000C0S@ 0 0P0S000 u]0p]P0"  /0-$0 -0LS0S0S R 00 -@LPTQ @P 0S 00S S 000CS`P04H$L@ p-L-uع$-/\ `P/0 !`8 0 0 (  , !/,LP-/ 0-(0@(L1M  @(0M0 \K0h@ -L M@0p(0 `c%PP) h 00S(01  0 (K`(0 AP"(P "PPկ#`pcٯ@ K1M  L@p 0!< 0`4 0 (   !/,LP 0-L@hP@]0 0-LPZ@QK0h 0-LPN@@0 -@LP0S0S0S0S 5`h xy101㤣9 -L`p@ P@@ -@LP0pS0S0S0S `᫥@nT?8@ -PLLDL0 B@P 0`@RT 0 $ 0-@Pp`DML!2 000p,`(P$@ @@ @ W 0!82 004p0,`(P$@ @@ @V1 0 00!140'>0 08p0,`(P$@@ @V 0!140'> 0 08p0,`(P$@@ @V040<1 00!,1 0'>08p00,`(P$@@ @V0400 00!0 0008p00,`(P$@ @V 0!0 0008p04P0,`(P$@ @ @}VP㈮<0(KoSp͵^^^^<ر^$F^,IM_p -LM0@SpP0S P 0@S=PB P 10S(KU7 0 S`* ( 0R*Tш40K 4 0 T 3[#[00p PỈ3[#[00@00`  `2s]ȡI H$o] -L M 0p0P@X` X /@0S  @ K0S  W @0dS*@(KP;@P(0S Sh0<h0K 5Kv 8KⰄKw 0\K`43K@ K`0KP`0@L 6#`pc0"`pb40 `~`@ p^ -LEM`$1 (0R@(1 a a ! 0S00S /01 a CK8K0SoobXP PK 01 `P$1S 0Sz000 K2$^P 0KU1 0S 1 1000S0S0S0S 801 0SD 0SA0s>h0  0x0S|0S0S.0Sx0pS|0S0S`V!.0 ` 0 D7` !,2Q1,2(0ЀK8!>K00K0P1 91Sps6p!,21 ,20K0E?K0Kx00 80 PPPQ`V IP  KCKUA?Ka a `0,K B01  Kv4C_K6S0(0K 00LKKP  K٦P  X5x@xP0S 0S0S0S90@ p6xP∠ 1 W0(01  QHL R P sh0 p  . H  B1`V" A      Y  (1( 1`(`&`X 1"$ #$0 :  (",$ "$ W Wnd0p0#$ #( #,`000 08 ^u Zu03h(("4 h#0R] R 0      0SL00S 0"P0(8ഀ<00|00000# 0QAA!,0000B$`p 0$D008 0 0 $1S !0KR᣿$d(KR  RS00SX(0#S*p wt 8 #8,1 #$$0"$(1 00 0  1 t(1 0 10( Q t1 6,1 (     `! 8#< *t`|p0Pԩ$ 0$թ`08 0 070hu]^4o]^pL -L M`p@r0P0 0@ K -0`L@嘩1@$Kk虩p// 0-$@L00C0"0t \0- LHyP@@U00000('t 0-L@Ĉ0 Q 01 00 S0  -L0IvI -0LQ k*^ p-L M@Pk`P0 K{`iKp -@LPU`P `T 0-,00@p`L00hP,P/00S0 D00S(PU000C00 0 3/P꼻5^ -LdM`P@Dp|`xP00 80$ 0( 80 0,30400 3vP ᧼0 P᝼0Sh0 0a0Ka K@SP0a0Kd0Ph0 @hX@ kl@ t l0t S(Klhk@Ps \ KTUP\ ` KDTPh T K0SUP 0%K`` LKX` r0D0 \0dKL @0 T04@ 00 d0Pp0 O \h@p7h0`V P0 `  `* RQ00!Tx T`@D|0 |0 `s00x0`018 < p\0` SQ  R: 8P V l00l0 |p`A 0S0t0X Kp0L0Kv a0[Sm h Dh.^=^^IH^0^f^z^O_J_^^^^I/^ 0-@L 90t -L0M P@xPPd 1UP`0 S`* P]0 SZ`  P RS?o 2R0SL0 0 PB Vp 㟠 `唱PP"DKP0 0 0 00P  U P0  qPP VV oU Q 0 DKuP$KP('I - QL0 $Q击 傻ꈲ^ ^^ -L,Mpᮆ@宆cPP=娆cPPTa0 QL0 0D0 0@0 <0 80 40 r R08#8P጑4K4[S(S| xxQR 1 0SL KsP PA 0L KḤ[^f^̔SI -P@@L` \ 0$0@STp u  Ro0 Rj^ 00-,00P$@L00T0 3P0@ 0-P$@LT0 $@ 00-,00P$@L00T0 @ 0-P$@LT0 @!\ 0@- H0$2 ĠP 2  %2 2048.0,v] p-L M`Q@ PE"`0?   Kp^^ -0PL@P0p3/4 `03/,03/&`V -@L`P0p3/0`Ff0@@03/ 03/03/` -@PLp`0 0  0 003/ 03/03/03/ p0p3/03/`hW&h03/ 0` 03/03/X03/Wp0` -@Pp`LD0 ]0 X 0S 0N0 I 0D03/b 0-LW@$003/$0 0(3/o0 -L@2PP``q开Wʀ 0! `! 0    !,0 0,0$0(03/ 0!!`q0    !,LP00S/P^ 0-L@P P00K0h/P -LM@0( `40,08P& 3  pp @pQ}0 5/(08P< 5/VF }_(04`0K 6/1[ 4 K#QB#/ p @{ 3 { 0 S- ( "( B/o"R>~x0 5/,0@ 3 \P (0\8pg0 7/PU,0 0,0P0P 00;)0,00 <0o_꼻^I -L M(0@`  ^Q 4P)&0K 5/2[  ,0  O K ,QpK  ^^{ VP ,]@[  [K8~0 8/,0@ (08P~0 5/P0 S] PXP%XPE_oRU(08`~2[ 6/x 06/(08`6x7 6/(08P.x0 5/?Rd(08`#x <6/(04`x &0K6/(08`x2[ 006/t0 (08Px 15/(04Pw &0K5/(08Pw2[ 05/(08Pw x15/(04Pw &0K5/(08Pw2[ 05/(08Pw 15/(08Pw: 5/(08Pw0 S (08Pw 05/(04Pw &0K5/2[<2K(08Pw2[ 5/,0 ty]y]y] y]@  WW Pp W p-L M@(08P}w9 5/@P(04`tw0K 6/1[ PUKp: 0-@40L$003/,0 < S`P^(08`Pw0 6/(08PHw <5/(08P@w< 5/SS ESH0_P[Rl0Sll(08p'w0 7/ -L Mp 0P(@,p00(0`4w *0K8/(04 w *0K8/2[,00,0(04pv,0K 7/2[  000000,0 K 0 #0  L 2[ 000H (04`v(0K 6/"[00, R,  R/  R+  R.6* R  R  R&606000(04`v&0K 6/2[ 00< 00 000660006600000,0000 -L Mp 0P(@,p00(0`4v *0K8/(04v *0K8/2[,00,0(04puv,0K 7/"[ 00300 ( "[00 0$ 000(04`_v (0K6/(04`Wv&0K 6/2["[0 00660000 _000 K000 -L Mp 0P(@,p00(0`4/v (0K8/(04'v (0K8/2[,00,0(04pv*0K 7/2[  000000,0 K 0 #0  B 2[ 000> (08`u 06/(04`u &0K6/(08`u0 6/[00?, R R 0 0000,0 R  R00000660000 0000 0000 -L M0B@`ST J JJ( J 0"S4_d 00R0H?oh, 2Q0S h3R0S S SE 0"S (04Pu .0K5/(08Pzu2[ ;5/03 $003/0  R= 080#8S\ S SP (KS S P S@P0(0\||8Fu 0:/(08>u 0:/(086u0 :/0  R= 080#8S$(08$u 09/(08u< 9/ \1Ri0Sf0 (0{8P u0 5/ZZ S 0S0SR0 #R   R  0(04Pt .0K5/(04Pt.0K 5/2[4 0R40+ 8 S(j%00S0S 040vO00S// -LP z] -LMp 0P(@,p00(0`4t .0K8/(04t .0K8/2[,00,0(04pt,0K 7/2[  000000,0 K 0 #0  0- 2[ 003 (04`pt*0K 6/2[(04`' et (0K6/(04`]t&0K 6/2["[ 00 6 60 6000@6  600=t&0K 6/2[@000000006 -LM,0@9!;1K(0`K8P!t0v 5/F _(04pt0 7/1[S}8 PU 0S , P(08`t1[ ;6/K -LP`t@p0  ը`(0 00(pp00$00,0080(004s0 8/3 L03è3 0b,$Kk讨z]^^(z]0^=^.^ p-L MP B@0R JJJJS  0"SUUS  0"S (04Ps 0K5/(08Ps1[ ;5/Kp03 (04`xs0K 6/1[V>01K(08`ls1[ 6/(S  0"Sp -LRP 4z] -LM,0@9!;1K(0`K8P>s0v 5/}c dP(04p3s0 7/1[SU PU 0S , P(08`s1[ ;6/K -LP`6s@p M  `(0 00(pp00$00,0080(004r0 8/3 L033 0,$Kk˧4z]^^pz]0^=^.^ -L Mp 0P(@,p00(0`4r *0K8/(04r *0K8/(04pr &0K7/2[,00,0(04pr(0K 7/2[  000000,0 K 0 #0   "[00 0 "[0000006 0060000 0-LMP B@0R8JJJXJ 0"S 0"S (04PYr 0K5/(08PQr1[ ;5/K003  0"Svp -L3P |z] -L Mp 0P(@,p00(0`4r *0K8/(04r *0K8/2[,00,0(04p r(0K 7/2[  000000,0 K 0 #0  0+ 2[ 00 (04`q &0K6/(04`q&0K 6/"[00 R60 R R6 0R R6060006 0-@L<(08Pq0 K0h/ -LP`q@p  ␦`(0 00(pp00$00,0080(004q0 8/3 L03~3 0,$KkiW|z]^^z]0^=^.^ 0-LMP B@0R`JJJJ 0"S 0"S (04POq 0K5/(08PGq1[ ;5/K003  0"Slp -L)P z] -LP`Cq@pZ  `(0 000 0C2?000(pp000$00,0080r(004p0 8/3 L033 0健,$Kkͥz]^^z]0^=^.^ -L Mp 0P(@,p00(0`4p *0K8/(04p *0K8/2[,00,0(04pp(0K 7/2[  000000,0 K 0 #0  ' 2[ 000# (04`p&0K 6/"[000[Q000000660000 000000 0-LMP B@0R\JJJ|J 0"S 0"S (04PPp 0K5/(08PHp1[ ;5/K003  0"Smp -L*P z] -L Mp 0P(@,p00(0`4p *0K8/2[,00,0(04p p(0K 7/2[  000000,0 K 0 #0  0 2[ 000 (04`o&0K 6/"[00 [ 0  0006600000 -LP`o@p   ⮤`(0 00(pp00$00,0080,(004o0 8/3 L03ᜤ3 0;,$Kk臤uz]^^{]0^=^.^ 0-LMP B@0R!Jp!JH!J"J 0"S00 0"S (04Pmo 0K5/(08Peo1[ ;5/K003  0"Sp 0-@L(08PDo1< K0h/ -L`P\o@pw P(0 00(p00$008 ,0( Rp0,0(004o0 8/3 0 3@$Kk賣0 $Kk^^${]^.^0^.^ 0-0P0 L@#R ?U U U  Rl 00S p003 00x@^ 0-LP@pP 0? 0nP 0Yp_ -LP 0{] -LM0(@P,0 000(0`4pn 0K7/1[ ,00,0(04pn"0K 7/2[  000000,0K 0 #0  0 (04`nn  0K6/(04`fn 0K 6/2[ 000 ![ 000000 6600 -LPpqn<@`F(刢  -p(0 0000S00(`$008,0$003/(004&n 0 :/3 03,0  0 'zl d0 qP3 @堢<,Ko0{]^^T{]`{]0^l^'x^=^.^ 0-@LMe(04Pm0K 5/1[01K(08Pm1[ 5/K0 p-L MP B@0Rp)JX(J0(J)J 0"Svv0 #R (04Pm 0K5/(08Pm1[ ;5/Kp #  R= 080#80C?o( 2S4` m0K 6/1[01K(08`m1[ 6/@|m0K 6/1[0 0"Sp -LeP l{] -LM0(@P,0 000(0`4pQm 0K7/(04pIm 0K7/1[,00,0(04pJ - 0PL48<0 0@0 ` 0000@ 0@0 0 ,0 0,0@0,00000003/ 0P,` 00 Kh $m^ -@pLPt 0`R00 00C 0 0p0 0 00 00S TP0p 0@@@ EKhk 0 $  0-LM 8 00 00  D 0 Kt^ -`Lp0PS@ S@P D TRX U PP q 0@P4 0p 0- 0L@ @  0K0hY 0-< ML4@ 0 00 $ ۊ00KPz^ -l`@0LpS@ DPP @ S@P 0@0 @P 0- 0L@S ~ K0hԍ^ -P`@LU@ 0RPP PE @ 0p P/P ///$0l1(0p10P1/ -L MT K0S 0S 0S 00K @0 4/K -(0L0S  3/ 0-X0P  L@R 00S 3/$0S0 K0h/ -L4@\P" P0Q 0000``06/#P`Np0 00U000w0P00 PGJ 0-LP5f0@ f 媗  0^ -`@PLV000000卝KhG -PL @`dUEP֙A0D00ϙ00 0S ǙKhÙ+^b7_^^_ -L`Ppe0@] RPMP0sF040000U R00000  "0 00Kh[^^^A^ -L`Ppe0@P R峗0PP0s%040000U0 40S | R x R@h 04/#P P Khn0 00Kh_^^^^dIJ -L M`Pp>e0@ἙP K rU00004P&"RPQᡙP000U0000|0SL0 H0 0S800` 8/#P   Ki\^^5^ LJU -PL`P 0003/Hf@p0 R @Td$0KhyU|] -@L` F@$h@PU0DS @1S P  0 0Kh/$ P00- 6@L$8U0S, S ǖ0P0$_^^ -@Lp F@$p@`PdU0DS@1S  0P 0Kh/$ x1- 6@@LP`\$p=UPM 0S48;S SA0X= @T6 0P`|10 1萔^P/@0H10L1K*Q U R 0(03/Kp0 R ` K6/PU0PE( 0  2/ -PLp]u@ UG01SE  nc40S 00Sy`u0` p`00Pj4P00 0000S  | R l R  $Kkt@0< 4/#P  ``LJ 0-L@]4Q0T T0K0h0 R0 K0h/|/ -0L@SP` 0P`4 R   03/P  0R  4Q000//?o2\Q00//Q1S ///40S0/ q-Lp@P`?o4 2R0S0 x@QPU 40`S@ 0@ 0 00b0@S@   @;^ 0-L@\40S0T   0@K0h= 01- 6@L$PM`\0S8 S 0AT 0S 0S Fp]`003/0S 03/0 Q   2/8000S 0  2/ 00 0$ 0-; S 0 0// -LMP@ `$ 000' 0 0,00$(00400p0 $7/P 00 004`$00 00`(0, 6/P400K0$0 0(000,00 0S 4 3/<Q %Q 0Q0 .0 /AQ BQ >Q0 .00 .0!0 . 10 .0/5Q0 .0!// -LM3A@Q vJvJ8vJvJLvJwJd0SP`$K` p0 7/P0 U:D0C` 6/0` 0d0d`VPPpEPwPE0V:0` 0d00 00CR00 09/pGD0 P0 5/`@ 0  E08/`0SP 0Spp`Pp \Q-L 6Q-L CQ-L& 6Q 4Q0 %Q/ =Q' AQ 7Q QQ HQ KQ EQYQ ZQ RQw0 .0!   0-0@00L0\P 0\0`P 0`0P 00P 00P 00P 00P 000T0K0h0S 0S Ҡ /0Qh0:9Q ;Q0h0 0 S 0$Qh0  / S l00A!l /tQl0S0000 / 9Q-L0Q*$Q !0AS h00 S 0h0(&Q;Q :>0ASh0 S l00A!lh00h0TX 0 AQ  R 5` R  R  d    BQ / d / -LMp<0@@`P  d03 8/DD000 00S<0@  d03 (Ko/PZ]PEU$}JP}J|}J,~J,~J,~Jt}J}J}Jh|Jh|Jh|Jh|Jh|Jh|Jh|Jh|Jh|Jh|Jh|J~J0 S0008C0S0C 0<00<00d\ 0P2!B Q0 B S:0Q0  bAR00000W 0 S0 0T W?o20SJ <0!0!SF00<00<00 P0.01SXEXQ<0 d 1`Q A02 ":/0 Wd0#0@000:/0 d2!cR 00S 0.01.0 1<00z B13/2(K<<}]l^ `00-<040@@0D00TH0$0LL0 0P0 0X0\P  0 00  00 00 B0 R\ 0 HQ0-L@ >/Q-Q*#Q  Qb 0(AQ0=Qx !7QW 8Q<0  00000@00D00H00L00P01010 10100010DQY EQU >Q<00N_Q]Q*OQPY MQX NQ00PQm [QhP( l{BY0oQA cQe nQ00}Q5 ~Q1 |Q00<0<<00000@00D00H00L00P0001010 1010001|<00<0x00*s\ 0n00000T  CR` 0C0R 0S 0d00 00CR0Pd0<JhP( lB 0m0,A0 00 -L MT@0 080\0`0d000000K -LMPP`p@ E 0 0000@080 \ 0`d0     K Q0-L@ :Q00 00 <@K0h/K0hK0hb 0-@0L 000tK0h -QL@<0 QQ Q <0Q Q *Q!R0 ,R0 !R0 ,R0!R0 ,R0!R 0 ,R 0 !R@P ,R @PU@ 0 `06/0@ Q Q Q /0!R0 ,R000// -XP@Q`1`!PEU0LT p07/`0S T ?0Tp D07/`P T0 P@`0S  0S 0d00 00CR00d0 -XP@Q`1`!PEU0LT p 07/`0S T ?0 PTD05/`0S T @`0S  0S 0d00 00CR00d0 -QLM@`' QQ Q>d 0D32aP2"5/ PPEPEU+0 pD07/`P>  00l@ D0R P5/`P  \@D0d 0P2 5/`0S  0S 0d00 00CR0K0 PD05/`P 0d0 -QL M Q Q Dd 032a@2"4/KD0d @02 D 0 @0 -L M0 @480gS hJS 0BSO @S  AS- $KDS_ RHS<l0d S0T X BS000`0S  0S00pd0 Qd023S0!0C00CPSL KS MSl T`XPR 00CS10N!0EL\X0T4T`XPcSQ fS XSld 0QD32`S0!2P"5/(S 1nS lS^ ChSl`P, PPl`R hHPLPpAQ@08 K 0`` 09/P; `` 0``   0` 00 ``0<K09/P <0@08011l0S6 S1 S, :SP SP SP SP'S$ SP :0CSP/SP(pC1S pPP40@0D0HPLPpPPPl0S0 0 08K8K cl0S S S< 0T 0C 0 S S pJ  dF \C T@w$p$K?c>J?u&^l?h?^^0^bO_^^^^^^^^^ 0-PL@U0U! \i=0  RS\ 0  C000  /R :9R0 B##S\ 0PC0w^ -@pPL 0!0P3/U P807(n 0!0P3/ U}] -@PL 0!0P3/UPh` 0 0P3/ UP<` 0 0P3/ UKh~]]; S 430/ <8#8SA3=8#8SA@A210/>08#8S2AAP00/<0D   P2A0A`0pQ. @Q& Q% !@Q @2<Q# :Q! Q2 Qv =@Qr $@QD @Q0 Qk /111111Q3 Q111QG 0CQG 0Qh17d1Q`13 0QP1.LQ @Q @Q. Q11Q& Q00v0Q 0CQ 0Q0] 0Q 0Q00/0P000000RЀ]+^-/^^^^#^'^+^o^s^b^I^]^g^k^^^3^N^9^?^D^S^X^w^{^-P0 Q  Q ,,," B( @0(S!<#" 0-L@M(00 00P`p$@K $ 00,P$ a r0PL ,(P @ $0a   p 0 0  ^$K+^l3^ 0-80LPS0 @,K0h> S-LpP S!  嶂낆@ `V q"*k ᕆV $0 3/D @kNT@@0$Kk,OX]C^8\ `P/0 !`8 00 (  , !/,LP 0!< 0`4 0 (   !/,LP 0-@PPL0S00  R  K0h0 0-<0L@SP0L00S0@0000 i<س,P =00l8J 0-<0L@S0ȳ<}i00<0K0hq -L M@`0@VSP(03@:rp40 S4  ScI@BY pp<0  0 R  HXppW0S Rpp 0<p0< P#0(K 4  0P 00 A00Z^ -@LPpA@` 0 Rჲ@) -@L`TP (0H0P00Pp] 0-@Lz40S 040G 80S00K0h -LM0 @R <"p0CS3 :4PK* p(&\ K0< 0000000P Q@ R@// 0p P/P // 0- 0LP @@ @ @  0@S0l R0d h 2/ 0l@0 0-@LNT000 -LN00. -L MPK %`@h PpP 0 4 R0 W80  (PxK8RWRW SW p- L\`P{?0@S  L00CS0𨝨 $ H0- L4@PZ?LP  K0h0$ @0- L,@D?LP K0h0$0 000/ -L`PKN`0r@p00p0000N0S 0X0S1`0 $e`000`딐 . d .`0  @0d0 0h000000l0`0SP 3`0t0000(00,000000S 0$@市OPP M寂嫂X P l\0` WPP P<$KkKpg^ |Jo^^^.^^J0^^ -LM`pPMH4@V D84V ,4V $4V 4V d0t P0h5/`$K3V 3V d0 0h8/3V 3V P< S0< S< 0S`PH3V +0CV 0V $3V X 0  ቷ pw`P c 8` ᑷ2V. 0CV 0Lx   |   0 0 000d0h`06/2V/ 2V 0 R00xoa t@000000000 0 0 000t@0000 0 000`PTA000 `P,A C4 @000000000@00000@000 Ɂ`P@ 0`0 0,K0(P ,0 `P9L ` ` `W W @W@W @W WW@W @W@WW WWW W -LM@`pL1 P T  0CT 00 0@#0T >0TL0S# ,02@0L R 00080@ L R , 0qx@ @T@00CS0A K@}f~f -@P4L  <0 pKh$-<0(Q$P Q0/ -4( \0^/ 0Q000/\ `P/0 !`8 00 (  , !/,LP -LMQPp  0q<0 0X `VY `$K0 6/P 0 S 0 0@ T`@ 0 Kl0K5TT 0CTI 0T`*G W X5T: 0T 0CTWW `0 0j: SPP 4T,$T=*0CT5 7=D Q q`0 @DoQ: Q7 > Q4 Q1I @GW 00# @ ,W 0<#X W 0;# 0PP @Kl0T@@S d00h3/l@ 0 @@a0D8#8S @DH$H 0D!Q00T0S; S< S S S 0T0+ 0@0S0+ 0A T 0S c0C S@0@ 0; 0; S' 0 @0D8#8 T:S00@2T@ 30D8#8S@DH$H8T@ /T@ 0@H$H0A1`A`|1%#(*$' p-L M0( @R1 $0S 0S+ P`40 CS4 ,0 0, !; S Kp0$K K03/$Q Q 0 0 %04,0 p -LPIp0UPPS@+UPp W&0 `U`RP0 0 *d00h3/`PPPPp U@ I 8}W`I `^^ 0!< 0`4 0 (   !/,LP -LM`IT0@S P))p0S 0$ 'LPU% ,0S" 0p0CS00 4K40 00 ;P !< p0d P GIH}<$K@;I0 :K ^^] -@LT0`SKh0Sp Q` 0B0%31B %! S)P0SP 0S`0P0P꼻Mb 0-P0L@SP  R 0?)d0h0K0h/0  0-@LL@ 0 - L`9PP@ @T@`V T0S LpW@0`4L`p@P Lp$ H0- L49L@T  L 0$ RL RL // Q-L u}^ -<@`P LF  `P0(0 J+:R0P0S/ 00S/ᰁ] 0-L@Q J0JPJhJJ<000000 0 00000000000000G-!0S@ p0P`ᴀQ+:S0C\ E F\@0TP`ᴀ000P@,(`Vp`W  03#\0C?0 Ԡ <-00000LDQDa \0@T ^? 0@DoX: X7@T4 AoP P U >  P = P Q  P P@PhUlNoV  ^Qڰ <y$Kk- pW .^ -0L`S@P S- 0` < R؜ 0  0  0  0 0 -L,M0`T@K ^@CqTPK|䁟t%(KPU Sj PUc 0  0^LAoY YPT0KQ p 00W@D"*  Q= Q R !Q   d\ p* BoZ  RQڰ  "n STx ~^T^ 0-Pd@LLT0003/X@ -L 0-Pd@LT0003/LPX@ 0-@LL@0 -L MpEPd@TU(K0`V 0 6/PPX@ -T0T@L0 F@ QCL`V@@TL@@ (  !LP  /H 0  !LP  //<0 6(001LP // -L Mpp㯯@P ^㪯PP`ï@ K0d`h00 0pw08@0p 0l`0^ -0PL `R p 姯@P@pDv0AT$@Pv0A^^^ -LMPP@ 0TPX0h0\0h0X0h0P0SLQ 003/P 0X T0\0R\0h0\0X K00S 3/`l0S 0`l p07/W 0-TPL@P0S 00S 3/X \0R\0h0\0X 0T00L0S 003/ -L$M`@D3PV ,>C0CVL G0CV 0V L0SP0S o dpWXh 03V0l0b3V 0VPl 000802Vp >:C?CV 2V0SI S_ SUn?2V o3C7CVdPp`Ud`^LP. \R\\b`qXWʀ 0! `! 0   , !0 D0 0DK@0  0!!`q0   , !(KP T0SL0S0 QT0SdPU 0 0RC0P!XP Vp 0`00CXPP P , 0q xPL0S ,020S 0 0 :/PXp.~fW|fbWaWdW,LP$ 0 -@LP F@``P@ @ @@PU T0S L0S@0P4t -QPL@P P`C hwpPd`VWPXQC@ NC <Jw00S 3/PPpX`^^ 0-@L]CTP0 PQ SK0hS 00 Q-L  x^ 0-L@P\ 4P0CP 4P T0SL0SK0h0^ -`T0L@Pp 13/ULpP`T0 0T01Kh/0T0 -Pp@LM`V$K 09/@ -LM`@pW$K 09/Pp0S@PRQ-\ Q <:#:^:\:0] -PpL0@C0`p0@@A `@!`pW8 b,0`@ -鄀LlL L`pPA@!0B"@p`V8 C,0p@ -LM@TP0L    lA0A`Pp # PR VpW*(K pA0A0000Q00 0Pe0 `Fh !$ Fa8 X  Y !P4 0 pW:X4  ! QY 8!  R 0 v- 0 PA ] S-LP@p t"~ `Y@`X8 +0S H-00@` R-L` \@p 0JhY P@Z8h #-0S h -P@ 0-LP@P 0S 0@S 0000R-`0 B"1\1L -@PlLPT U pP#80&0Z8 0S  ,0P0ppU`h pP -@PL`0P"0U#80&0P`V8 0S  ,0P0 R($0 0// -Pp`L0S Z@+p 0000@ Q000 KhZ4 -L M`l @RpP":pQ:AQ  A8/ 0x%\ 0 BP #p Q BB<"0 9P* K0 -LMl @RpP:p Q: BR  B 8/ 0l 0 BBl"%\0PQ 9Q*$K0 -QLMpP`@@C@0HS`0 p0S@0IV$K`0 `p0VH@D -LMR`p@@DT00 0 00 0 PU$KP -QLMpP`@@C@0HS`0 p0S@0IV$K`0 v`p0VH@D -LMR`p@@DT00 0 Z00 0 RPU$KP 0!< 0`4 0 (   !/,LP -LM0 H)@`QUʀ0!`)0) )   !00ZSP0@00 P 400$0&Y0@04 00$00 , 0 4 00CSpps(KT0 Y40, @R0 4  40 <0 080 0b|` 8`p `4pX 8``ApR <`p`FQ0S`T0V`40 000000 S Z `0 dS` Qd`i@240  de l 82pqhpp!PpLpx  ! 000| 040 \P 0TT 000 pZhpqgp s2Gd 00C0' 0R0p0pC W0 0RS0C27X5A0L50D50@50<50850451000Z%0 J0 Z @JJJJJJJJJJJJJ`p\p/ ` `.5;S? S S `L>`l̠ \" `Apppp0pppppSGQpHYpppppp)0C2.c<>x'x(W<8L"(#8`@4  㾀Q \4 4  X:꾀ᾀᶀᶀa 0N6aPn0 A0 >3p aQa X:    R  Lt5( (s@`p 0l R0T0: @($ ,0S X`YpZ0F<0 0f80 0GD0 0g@0 0HL0 D0h@H0 0PP0 V ^80<0[R33W ^@D1\R))XH ^L]0R))\3 \\4 0P0S\ \T c(#"$c4"T $ 8#<8#88T (4(#<0<(]x^^^^UUUU7] ̠ S / 0-LQT0   R: ,0 30,#1 #2 R0 R,# '4] -L MPP `0p@!L,`1 V ` Q @0" 1!pW*(K00#0Q00`0@x b 0C  2 1pW:x  !Ry ! R 00 3' 00` @4]4]] -SL4M`* 儠P@ A 040 0 P8 00 c1!0  40Z P0z c028Aq8 (K ^! D H!@ 4@A$$DL \@ @$$D1!DH!@@  0@1!! @$@Q@ Ph 01\ D0 0@0 1H0 0c0<0 D0S<0 HD0 R"@T< 40q0ZpL0 @0  p p@PA@TH0pGB @BS 1T0 1X0 0 P 800Cs80 p H0SD "<<"$0, 4#,,#4 <0@  R d R   ̠Ġ  1!,,!  0##4<!<<!00@\ 0#00#0X0 dE^fP0D0ST L0AS@,< $ <(,Ġ <  40#"̠4̌8"$,00L  R4  b ^   ̠$̌(   2. $ (.  00 <Ġ #,,#4 <00 N^<  48  0?00<0#ş0 "  0S T %00pPD<T!,4,8!0,04#$(#4 <  !48!0 038##4   mD 0004 1 00 0c S0à 4,  80,Ġ  00 10 H0AZ@ @ S 1T0 1L0 < 00@P0 0CP0 800Cs80 X D0S4 S 0#,,#4 < 40<#"<<"$,004  R4 a ^  ̠̌  1.| t.p0#  #4<00Pp03W#̠Ġ #4< m0<00#€ 0!R B L0p 0bX0 ^vL0H0SE L0,<  <,Ġ<  ̠4̌8  00@ P b R   ̠̌  1"" "$, 0# #4<0# #4<0@l 0#0 " 0S T $00@PA 0pq 00P0100 a Q ́  P |R 48 002#  #4< 48 0X 030##4 \4]4]] -LMp`P@A #` !&V` QP0 "41X*(K 0"00#0 R00`0PZ1 @b@L00 00BB00Z00140 ?1X:Z  "  "  R0 R 0 "  "  R 4 80 # 80` P B4]4]] -@L4MP@PpWpCW{*P a`b. @  `P"( &  V`", &  S Z | $8 0,@ 08  Ql%S> 2 4 00 X9:808 80 $"448 8 #848  4   8 @ Q10""Ġ0$0 0 0S0`0P 0"00#0 R00`0PX*0 0'0c PR'`R (K裯,pK 0:,0 B0c 0!00#0Qa0@ $ !L  D #!P  H D Hr  b@P "< D    <S0 !X qt0p0 cR2 00 <0 T 14 \0 Xh:808 80 $"448 8 #848  4   8 D r @,K00!QD" "$,  <Pi\ H r0S X "0`0PD0s0L0 #  "0 < RGH rP !  " 0S X "0`0PX*0H 0'w0c <0PR`W; 0PED0s0L0 #  "0 < REH rP !  " 0S 0X `Fb"pG B ,pK0>, \"Ġ "$ @}Ϡ,K 0< T PH"<< 0"$0, l  B4]]4]0000000100/\JJTJ J -LM@P`@PpW3C\/*P`!'P*( V& `Pq*, & S!80pK/ K#8( |0$p|"p8#8Y%* 0'0c wPR`)W=(KpR R  80 ! 80` PY: !$$("($$pQ  R  80 ! 80` P,Kό\ 0/[PE0 S 0S 0 `F!pG -@L,MPP@PpWEC ZA*`!. V"& !P`0  Sx", & P4 'x7 |0$ '2 *<  8 @  0D  L0 H Y_*0 0'0c wPR`)WQ(K0R0S  !0`0PY: 0\40$ \00! 8l<0#CX0D0cQ[0P0 @0>.Y0N0c^3\>P>HL!AZaP]10 X0pS   0`0P 0PE0 S 0S 0 `F pG44]T0 (0X0050 0R 0 00/K K -@LMPP@PpWJC\F*`!. `P"( !y V㊘", & !` S0PsK"K)80 X:80 0pS0S  n 0`0P$p|0|"pX*0 0'w0c PR`W((K0 $"44 8#84 4   p8  R 0S  7 0`0P,KQ00[PE0 S 0S 0 `F pG -@L4MP@PpWpC W*`P!, ` P"!)V `8   S", p< Ƞ,Ƞ4 * |0$ ,,20  D  @ H  0L  T0 P YV:000X0 0>8S0S 4 0`0PY?: 0^<0$ ^80! @ nD0##C$X0Lp0cR#[0\0 H07'Y0G\p0cZ3\:7P T "BZ  bP] 20AX0\00000 0S 4 }0`0P0 0'w0c PR`W(K0PE0 R 0S 04 `FXpG<4]X0S 0 Z0X0R  Y  5[ 0 0R000/ K K,00S/  R 0< -`PLV0@P0# (( `  p $ 0$p՝P` F0`000   @@<"/ 0-P(0L@T05/@<-X0P H \  , "  <8 -pL@^@P P@@@ @S PUR  ^V WQ P@^@<0 N R C C@ B R@D @D@ N!N' -`L MpPd0@T U000(K 0 0 0VP`@< -P`$0L@T 5/@< p-0MPL`0PP@P  , 0< 0 00 20Kp< -LM@(P`p W XFp0``aМp0F<0 0 S$p`0000P ٜۜP(K0$  #80 0S"140 0 ",B,08噡*S: <00垓#4 0C0 0S00 ^ -L M@(|Pf`mp  @p0``a[pက0 S$p`0000.P geP(K0$  #40 0S100 0X3 L1`0L00 ])Sr80xq 8e `H ! $P0  Q?K80T1 418<$4;Q?K 0 Q?K $8 T1R 0TQRQ*T180  0MK GKK q W0R0KKH  P 0QK < 80$+4 4P M?K00T!0?gP "4P 0L00 X10S >K @`?P 01L!0kPq 0 S/ 0 B 0-0 ML $ 00  jR KPh^P/VP 0|0 8?o20/ 0-@LOd| zU|0P -LM00 0@0R9!(0 8[?08000P mK0S  10cK ? R 00 R (,( @(@ ( ( ( ( ( ( ( @( ( S K  K![   K  K![  -@0Lv YpP 0 `   1`S 0 C10c<D1$@dP0p0@AD  @<0  B," 00dS(0 ? 00o| 0-LMP@l@K KKK K 0KK0KK0 0-RLMp(0 x@XPh`!(0 (P $K0S 0(K0c ?( R 00S=P   PPX -@LMP K0  `p @0 `<6K0( x00/0 <#<0@00( x0 0/ / -LM K K -LP@` ` ` -LM@p` P0@ ,   0 @_VBKl @ P"K 0@PI000$K&\D  0K 0) -@LP0`` 0 000 0-@PL0 00000000CS 0  -`P@0L%S @h z@ 0X  q@ 0x0 h000 h0S@h @ 0X  @ 0x  gh0h0 -0LPS0 S( S& ]b@`S S@0`( 008#80"$R*0( 000`C@$@`\`@`F@` $0T`0$`00s^d\h\@^ 0-@PL] K0h{^ -L$M`000 0!p 20K@ 3[S 0\0P00   S$: R  N Z0P R`0 R Q\Q\ <0 2/<0P R0S1 \. #K܃K( ?X0%! ̟?P 0 80< L2)L<0K b8>"9P 000000 R0P 0S(K 3/p 0-LM@0 P0!$ 00PP0000(0$0S S K0.00(0P(0"0 B (0 @^ -LMP $p0@0( 堡0 `40 40Y :(0$p`000@0S0005T"R/ ` p@T @ T8 6:T @ \뼂 )T T" T@pG `"`V 0( 00$00C$0(K pG`@8 8D D@@ F p @^^d\h\ -0L`SP U U@ P|P  < 0rP0 <0^^^ 0-L8MD ( DK @0 KĞ] -LDM,0 x0H0 0@( 0K !$ N0K 0 O4[S0 LK H0 0H0 LKtK4]D] -L8M   +!K (0 0 DK @0 ^ K负] 0p-L$@0a@ @0 0y(K@P <^@8^ -L M0&0K0@%0K2[P,C R pC`0P" (,~P{b T` 0RX00 K0 0` -LsM`0p1  (1 p 000"&pP@0@q/K yFP!4"6 0)01, K201 @P>K000;!0  !?pP1 0p1 P 1R R 0S301 U he@h %r/K0hpp (0!0(01@00000(0:(0,0<,0;40 0001`010pPPP 1  0P 0C#>K000?pPs10\p0P00ãp001 p /000LI Xp 00p0 0SEXH 0p0AX  y P tP_o l RPlP) U+ pP$pP-@0s/K EPq DUQ P`XЁ \P 01 @dT6Z0X0PX  ep(Kp@P tU oX jT ῐ00edA.^^^^^c -LM`RP} sRz(  X@ @@ p t $K@  Pb 1( Kq1 @P(t0S 5@p0'P(5@4(:00(0& 00Z@P(0((  ID@P(G0 (w@(~:T (MD(G(U5(G0 000 v@0 S p p0!QP@ F(85@T] 0-LxM0Q0%P@ K||@Pt 5K00K @ (@P 6  -8- Ā^^G '- LP `P@t0S dD : C`4ۏ00(0:(0 0-L MP @R@$K0( K $!K1/@P00(|08S4@F@K0 0-LM@K a0 X6PP9PP 400K0 0-LMP@,P 0K0@-0 R; r8Ap`UT2bWV.0 r+HUT' r$x r!| r r rcP@WVDUT r "SR 0t0 CSR-- -LLM@0S ؀X00,0P|`L X0 0 00t0S(! p pP0L \ 0P0X H0 C20 0000P (K $K L0H  l3<0 \D0 R1QD0 UH0$pS<@0 L0 GQ1L0 KR%K0P R$K 0 L l2#K00CSʺ0 V0  =# C!  R%P 0S = C!P0S c> Pc> -LLMP0<0 00P tL0 Qp2|(`$0P0 r?P<0P,TR PH60@S\680 H0  <00#280 \80H \`60PX6<0 P@&D6 0KLpP e(KL0X0 P00KX}ЀX0 X0Sp.B.0WP'0P 0 0P 00K000 L\PP0 00pW ԆK   ? TP TP WP R Wt H0P <e> 0X& 0T0 0Q 0B0 0S0  . X0B^ pS0`2 K 20[S0 *<84;@0 4D0 $K ?  0C  ?o  20  20K ! -4S S 20[0X0SPP .0-400,00`680A00H  h@^@-H0H \0?0A@P" 1]0@-@Q0ST L0R PPU00A@DS Q U 3=?000SࠓࠃQ^U ?6?0000- A^ ^\CS0Q Ӂ0ѳ 0ҁQ/0 -LM@`1@TP5p4 KAa#KS#KR)< ,[+0[{.B B2$U 17V l!<RX!/U+$K0V00U0;ų p-LMPP`@ 0 Kp02K1K(0 20Ġ$0K50 !0K{Ό2 ?0#K,K, 0KK` P? d0 ꀖp@-0S00R0100 ^# P @`DS!?0 Q  P. 0Cl@ T @R@A@^00p0S*0R] -L M Pp0A S0 00.SR0 .QR 0@0S Z@00W@@(K \.\ B0@ T .T.Q ^ZS= QCB@ ԑA R\ \@C 㬑L\00R0S`)\@R_000S00T? WQ0 `X T@^ B@ 0\ L S.S @0X S0200`V T@S B@  )0f VqW|.`KT4KW 0Br Q c HR~ 0F0 PVm*00] -LM@p`0 Q s.R R 0G 0S/KN/KKY0` 00pp 0?KP `a         X@PPĥ(K -L"MPp@@ `ZSX `$K/KK$ X0@ H X K _   [  W T?KP p@P T@o P YpW 0SR@BOoB$SR 0!1RQ@ 0?PPET /K] -LLMp?00CS@`(K@0 `0RpPK   fK  ZK 00 R/R SYT@K 0 G 0 '?Q QPR0S @PB 0  ("(R !  B#  Q PR!?PR !?.0S AP R/030 -L`0Sq.\ \ R  0  /000S/| 00/0M000Ѝ/ 0P @/0P0 p-@|P|`|0ML 00 @`@xAP0 00 @`@A(_ Kph译PP^^]/ 0- @LEEK0h衑P -LM Q|L  K. K -@L$M`0K 00PS raL S^,xB@x z !008P 0,0$0$00040XE 0L00s0X0"P0L0X0 !0\M $55%5L00t0 0t0X0S  40KPgd 402\0,XL0|@0L00x0t10 @pd0`IS< 0 10@ <0K0$ 80K Y pP D K0>00C00$ \ 0`0 Ki^ -L4M0@8P 40 `L0H  0s $ <Mp(Kp 0L50\0S* ~pp0FD0 d0V80H@0 \X0X`40 080 h # Zp[ 80Kld0 @T0CP A)A 0b03"$pP00p 0 B H00 9 Z0 000@  0\` # .pV8 r 0040KPd0D 23h080l04Q 00#0 p 80KHSpP ~ L H0C200 0p1^ -@L|P<P '+00`Q崏|`BP p-@LM( `$ 堏(KEPPۏ@PⓏ(0 0$00 001 0!}00ďKpP@ -LM X  t KH@P4寏K 姏UB@0@ -0L`|@@ RP 4 R`0(PP\0S  0P0$ @0 8l@0 0C?o20P -LM L@  & K8P$aFK0 0Z@0 0-LM`0 x,0 (0 0Kh@\PpET 0S <> K \}A@@0 -`|@xLpD2 @ Q ! H0P0,U xmx 0 H-   1 `00C`0`0  0`0 1 / -LM K K0M000Ѝ/0@-`@TPPtPU \ PU*x^\  0 -L,M`?oPV20R0<4 S8@p (KX R@ &L00 d0\PV l 0CP 230Wl0CL 30V00Q \0d Cp0X0VQp0D K00D0 @0KD 0HS<0 0000h00 00D @0R:0#0j 4P W@0 ld C@T  D V0& PQS\ R*4P   80K000K< K<0 S 4P 04Kl 00 B<$"~Pi<800 @4S:P \00sp0@ Q@ ""@ @00@0 D00D0 4V P D0l0Ch0cH0 `\!'0S/ -L M` @RP/ `0S 003\0.0Kpl0 0C#0$Pp0p`0$K00! z0$K 0!{0 V0809=p0\o0C00D0l $`0 B00"$8$ 0 0000 '0P   Jp.0Sp(( P J$K]r^^ -L(MR@pPv\0Ss:0- 40K08 K00K 0,K0l 08 B$"`P= ,00400s7/0@!S  R 00# ,0R( r. AR040!,0 040 "  "Ġ #K8 ,0,0 0t0,P $K0 40%SKP040,0" 04$K ! ` -LMP`@0 0 0KjpP KT 00@-0@ l ol0LS1! cQ\51: P0#03Q0#S\ 0l o AQ1 -@PL4M`H0 QU(Kpi\ 0H0Sp`đW 0t00SP0S0D <0K0@ K80K#4 K   8 l0$ @  0C#0PH0pW1`P4< % p+ P0H4  0  0 20<#4K0<0R00<0 < 80R*W@ 480*ĠᲤK<00 0*,K04 0#<00! )<00 -L,MQ@Pp 8R 0p00D<KQ40C\0 9D0 3 0@0 `0H D  R*0H Z5:V( 0Yp0 0@  " B r  /oJ L0 UL0 0 0 0p(KV`1@ 5  " B r  /oJ D0 UD0V`1@ 5 mNA 0-@P`qԁL,M80 U\0S *8Q 4  K0? 00K0,0K4 K40S 8Q  i8 K   , l0$ 4  0C#0P4`20S s& S80000<0 P8 0:00 3K0#400P80000&P80K0 0080000 P80$K 020!00$ 0-@L M00 \ S:0`0q`0\00PS *U@ ; 00 x) UQ 0000s(0S `U wP(0K, K Pz0 K ( l0P ,  0C$#0P $K -L$M@8PX`PpL00!h0!s00P0hSh  h0p0l0t0V0 l00l0 40K P0 (KX0 Sl0040 00K0440K^0P00X`F400X RX0 0l 00P 480 n80h  00C h 4 00Cl00 L0 00 CS0 4 dT040 l0$ BL,p 0C#0$ 0WpHM!Ѝ/ -LtM0 Pd0 0H0 |@l d 80 4pP )0t ` (   CRp(Kd     P d00SpL0  / 0.S,R R(0.S%`0BP` VrL `l Rt R3 tX0   l3pPX X0`BooSb`V $d008KBP P5 P0p0 ` p  $0`p0 0t@l0`0 C/oQ" R000X0 0 x@ |@ `0 \0@ SEL0K0D KP0Kx P P: px  0`lD A)A@ 0bHK@L"<3$Ph 0h H@L0Sx00x0 00h  \ h X0QQ S0X0 |@ Qy0SO 40SL  E3pP3X0pS0X0 X0|@S0FB0F,@00%S0X0 \0 0S0 00\ `0 ` h0 0h0 F\`  P p0S=  \8KZP7\0 0KSP0l0 `,@SR00\0F00\0RK\ 00 QK[`q \RK\QK[`LQV R V@BP` HX0 kX00`0 P hR@l t B/oQ" R ` X0 ( t  2pPX X0`BooSb`Vpd0 P X S`Boob`V #d00d00 -d0 P rP S`` P` B -LTM8@0X \ (0pP0 ,0PS:p0d0A1000 H P 0 \| (Kd \0H2\0,d@0K00H0K4 KTPlH04 A)A0Sh0DK,@  0b"<3$gPh`D @0 0` `%H00I0 0J0 0L0 0M0 0L0,K  0\0 0!800sP0@0T0 00S0P0 \ 0\ `0 0,d0 000h0 0P0 P0h S#:T0DS %X0S} L0 X0rH0 L S0H0 H0S<0K HP0<0X |00ah0pT0DS5 d@0K `H04 K06P,l4 A)A0 0bDK@"<3$Ph0`D000`80 0d` 00\0 H0P0P P00P d,`@0K4pK00 6|Pl4 A)A0 0bDK@"<3$PhD0 000 0X0 P0X S T0DS?  `FPfh01T0DS) d@0K F0 08;Pl4 A)A0 0bDK@"<3$SPh0D000P0 `F0P0 P H -L$M`8<0K04 K0 @P @DOoB(Kl4@ A)A0 0b8K<"<3$P8$<PW h000PPP K -LM 0$ 8 K -L$ P (, 00 RxPQrKQ Qh@@ 0/-/0M000Ѝ/ -LM K K 0-@`p Lpp X@`@`b $@#0 4@cdd -LMPt0S 0SGB@p4K0 0 K4Jo`P⩒4$$0  $/P@$ 1(Kx$P U0   /P@V^K -LM@0`S@P`0p@|P *K $ 0KBK( $ PP ,K(K -PL, (K8 d0l 0C 3ß#KYXP -L4MP0S (KP00@|`\ P0t0S8p. pp R  \ \0P$K0KD0S H0D C20 000P 000 0 = ShZD $KDd0hp@1à@ c SΌQŒQ@ 4 R300 D0\  0 @DT@!0KKP0$KR 0R<0K@04 K0 ~Pl4< A)A0 0b8K"03$D Px8 p00 0CS@1 D8Z0ST -L,MPt0S S ; 0|p@ 80 8` \000 0P00S(KX0\X0`0(0@0D0 \0<0 < ʟP 0`,pd 0R ``8`<0 PYQC 1N`0 /PV 0 \ \ >0>00S HA00`, #K0@0 H0@ C2000800PD0SI 0S\ 07X80  H}ԃK@ 00t!0 0\!K 0/+0000ZVj80X -3 0< J`Rp`\GPd V40 #00 (CL8QP |  0` #K 0*P R1(Ko+)^M!Ѝ/ -0 L|pt0@S|`P IP W&1 -PL|`|@ V@ P  p!@P 0F0 -!0@ ;B@ -LlM0` `p ` d0 ` Rp S `R @p)d0S dP  )`@S `0@P`|PL00 0S 00.S |0S 0 p00 0 I)@000l0 n|0h0 d0`S|00 h0,0t0 h000|0 p0 &@`,)|| l0XX Q00Sx0 0 TS dz0d0 h@P `0p dKE@P |0h0 d0S! |0S L ; 0 EP l0S0 hX@Pd0 dzd?d@ \ Kp|@PU040 00(`?0 `K@P ((Kl R @`0Sl0S 9(`|0U l0Sx0S X0Sj|@,00  PK \K h0t h, |0h 000 p0Z@P PK `z(s400400 ,0@P0 `l0S 0$ tD0 @ ( 80 $08K< 40 (0 00 d 0@0h@P @t0`40 80Sh0t @040 D K0B80D K` 040$000(0 00@0r8KlTd  Bp0C2 A)A b"30$@P80h 00:!40sh08@P `6`(@dP aQ000B@@3^J^ -LM@0|P0t00CS9c)WV`808 dl0A 0Q a6WQ004`P؃YX$ 000#SR $Kk'8l A0)A `18< #$Ky^ -L M0P|@"X 8@8 808!$!60?77K^^.^0|0\ <v -LM`|t0 S #& ` ( !L 8 x@@S p @;PtP2 I02pP!<0 ;$Km00C SlKKKDK`KKlKlKKlKxK 0` / 0+ 0 0 / -LM0|0d0 L0` p00 0S0  $K0 0d08P0!0.p0@S0 T0  0#20 "p0T 22`0 d0X0S rL S$K@R0L0Ж壂0P0 X@00s 00L RKldh0l A A1< a20X0 1\0 T0`K,<, 0 0X 00000 ,, Q000Sf: Y$K`Pf 0$KT0S KT 0P  P P RTT0 dp Q a2SQ\ L00 0Ch 0IY0 010!0 d0\ \00L CY@0K04 K<0Kd`P9l4` A)A0 0b8K@"<3$`PK8 @00C S 00S00 000c00 8000 0Y :,$K K` R0VQ* &K 0 \0 0C0d0\$K R? Q0R0 0 0S VP   0Yo0 0 0Ro(KQ 0S0  00 D0K :p4[0$K 0 $Ke 0B0K0A0K$[Kq0L (KBKAK[. 0dl(K@T0 )K(K0/0L NRK0  n><20p0 >t0 K)K` <, 0 0 0 nP1   @04K00S'*8dl d0KP0C C c3̎|0 T00"x KH0K/0 "2- 0 00  #P 8Y`6$K 0&KT0S KT 0P  P P R8B`T0 Y0P0 \0 $K&K\ ?*K0P0 a$K&K@0\0 $K&K@0\0 `*(K0 0~@^@^ -LMP@p0@`0 R@,K,@K0V 0T0,L0 0L0800"0 VT,K,@K`0R 00 W@T,K,@KM00P N0000K -LM0`|@X0S, \0RP#+* px KT KPP 00 CQP\H (K %K#$00$0!$K808 $KQPā#%K0L#0 0pLpqp' XppW:#:S%KP0pp 0KP T2W" H0C2000 0 P$ 0 ?W !KSR 0!r#<@P  00   Y B P 0H0 K! 0 4|a ?0) qԅK40|0 lK|!  ?R$K0# -2Lp0S 0`0@P0PDP@01P10P0@dq1`V6 0S  0 Wqq@4Pqq1!0R1q51SG<1!0R qo!1SPP101p1pq01mqiq%qX  5P #P 0 Wq4!P JqXP0P1S>q;q謹+ -L|Mt0Kl0 #4;lK$`0 h d 00`Pt0 $0Gf\0 p0 5 #4;V$`0 d 7 X lK *B@L ` p, X p , 8x0K0L K0lKC@በx0[S 0`:#@\00(K` V|pI tX@ Q Q Q>,&lK000A@P\ R $000C\@ %lK40040 @%<00<0@%&KH 5lK1"N@VP0800`5lK1"K@T&K%8->0C6Sy`K0 LKP @ 0 `000 00x0 00 峟 0@`(K0S[x0`$S``V "p@0Sx^p@&K(K0@$X0 $`(0lK0(0y0K0x K0C@P xp?)KW800 o)K (K4#"(KK3`#R 0V03`1`0(Kj@P(K`"(K`+#p尟y0[Sp `b"m00+ 0U&KK0 QPo1300x0 13 @o(K*0`(Kz0@x0 !3B=3J@z&K(K$0T0 z 800 o$ ? (KZ"P@$ ? (Kg"P' ?)K11000(K3j@PV! ""8oGT%\@ go0 RoL0KY 0 "(KK#R K`)K (KE"0#B-#1T`!@@@8080T0y0KY@W/o0 Sko !303 o)K (K-"o0 R90#B-#@@@808.#^$1u -LTMP0 0p`0 0S\ b t0S R0P(K|000 `0040 x81D0 400  401D0P 4%t\ @P40AUT\0 $K0`@X0 @0 L0t Q  P (Ko>0D PPP Q QN Qt'000\0PU&  00! QPP0<0 080 #KSRKH0<  C20<00 0PP 00!QP*V0@0 9PtQ Q` QX fUm0SV@&00000D0 0;00@PPXl 060LPP CK0`P@0 kfV`!PD c@P 060 %*PP 0!U%(0P 0D0u$0L0 0T0 T L0S 008S ؀00!YX0\T L00$0C P 0< <  R  X #RLX *^YK00 CSRD 0D0P +#800800040070 `P 400 ` `008So00!QPi0@#000P< P< YX 0H@0 L <0T0B@ <0 0I S103X0 5@000L0 `00T0 L0X*0L 0Rn*0n@0 $00CY00 C$K)!<00 $K400 0 0  0K0K% 400 %KSR0 0  0K`@0P0``t1`E0S400S008S ZDPIP 0 1 %0600~P '0PT0S 00 C<a4000 0P < 0P < i%$K@X*P\$K X0S`gN*dP#^ -LDM$@`@@T  |0T0 0P`000<X0 00U RL KP d0 40PP0 d0 + X pR Z !P U PX?T08#10#W00S TylXTlP L0KR  (K1 Cr#ӑ #ÑlP [ll0!P!0BqґB‘X0S &KT0T8W3K0p V5K!>4K`0@` P @d K0Lh4/@P 8)h匤(0( 0 0^|i@^^L 0-@@LPX\jPS(010Ā^ -PLM@ `Kd K0 K0@P h(K\P\0p K7/PD @` P0 K5/P (3^|~i ^i'^ 0-` MLpP0KM@P (K K K!> KKP0 @ @ ` n<0 K0@04/@P (A^i|a^  0-LM!K000K00  f K   -LM 0K # 0  0 S K !>-LM1K00 !4KK K -@p`PLLMd ` P@ @TaV`|0(`0S ᬌP0T 7  `03/P PP p (K PP 0 d8/P (T PP XPP TP STP 8<0 X0K04XP PT0KL KPK:/#PX PTK03/P0TS2 0SP0 00P0  000 C]&h0K00KL K4Ah 4/P#P00p  0@P< R l0R  C N 6l0 <0 h0K0p0K04Ah 0KL K4/@pP $#0D?oU20S 0 )#T T0Sp0Sh0H$T0S @l0< 0Cl0 ,Y @9 15倀Kl0 <0 h0K04Ah 0KL K 4/#P@  P#P@ l0< T0Cl0 0S @T z @xP ˅0 |0 0x S0x0  t K xK |KPt  嵅N40Q$(10(1@f4Xw 0S0Y 0 0|00x00l40S8 8\, (4#\ @  1 D T\ B!  !  80 h 0 l  D  T $ (  0003 000 s 00bR0lh0Y   P:ll0 00 0h0 0b#Q@P @P` T00 0`( "4`#/ -LLMp`0 `0P00Y0 H D%$`(,,56D0T H<0 4 L0 P$KH  :|`#:80 ?%Kt R Xtv40d0T0p0<0t040x0 L 0 P QPX@ 0P S 0L S 08 S%KSR`0H S 0-80X0%K(T0H0<0L040P0$K%H0 `00&0p0`0 ?!> X X<: Y`0De03T#XL3 [4X0T 8<0 p<040  O?4 <J0 Xq$K0H0 {X8c0HS20d0%K'.{;00-L0Y 0P0 0G "00 40 #K  4 4 8 4 <408<0@40@|0 0)"`ASRSR 3#,( h1Z &<(K8,( (,<80p@ ?@ 0|0@x!0S`0ʌ%$c0 00 !%  8   (088 H`P]%p]d]%@J 0-LM@ P`0 0  K0CT D P0 oK0 0-LM|P@8  :8-%b0 00 !K0h)%K0 -SL,MP`t X@1\p #K$SRGP Zt0Z㔡 S  QP;`0 S00SX1`0Y3 b1 4 10B !S0` 00N 0P00H0 00000`00X0181401b (KP0R000 4 10BX SMb1 `8N 181b@J^^Q^^ -L@MP` pX nXL K000 0`0$(0 81 !  :1P`V& V1 -;;:10 0s4 `P 1:10 0b4 `0 000 000;;1꼻-^6^ -L$M@`LK pP ?zༀX (K Z (20 ?R0 R00 000帀UD@0;0000@<@KᨺK"RQP(40 S L0 0D00@J -L,M@0 0P`<KH D  0 T00Cz S 0D0  @ K DK HKX @P@ A~s< ?@4#K14 @P`KPDʤ!0 SA008@p T1 , ,0K 0040050000@@?0S0 ?0 ?@?/Q P@@0S   0R00   RD DKHK @PH0 0D0 0(K@J4 -QL@PP @Q@ 090 0^#D R0p`b0@@_D# R0p`0b@@ 0-@LP^0S 6K0h^ -LM1Q刡`^0S 00"^(Kq崁@T0SZ@^WLKPA 00 0^0#K-K y"K *K KSR) 0K"KQP(0l R  t0K00 R 000A^ 040 0!@!KQP0| R 00 !/ !, -@PPL^0S00  R)  `M^ ^@T 0S$p4P 00S0C04k!0S00 R @4Kh(^0V!0@, Q0-L@ @Q<  0@9 0$0@0$00PP]$@^0$0$$@ 0-$@L ]K0h!?^ 0-`@L0S ]00P!0!0S]] K0h! -LM1Q0S S% ` \1H0 KH" 0$ T 0@(T @0 0 DR23200   (T7T1S  ^^ -L$MPp` !v4P@0S1/v  \P7`$IV   Q- @$Q  ! 0$P #  B X @ @0@0P2 #101(K#0 00# $  #  P@    <K_Z  M@ @ R @ R  P " # <  0 3SH L0SP0\ 0 zu  P <  0C S00S 4    D @ H ED@ PHFQ<GLGL #PKL` P0 E`P c{0   $0K0 # 0 0) 㐔`P >K 2"@K4K&`P80' >9`1Q 0`4Q  1 $00R0S 4 [`P 101q 0A  10100S+x` |V`1eeo∀` $`P1@010@00@1E:d`TPLH``\`X`l0h`p`$KS x` |V`1`eKn∀ `0 R  00 $0K0 # 0 0|  0 R0$K00!|x`ሀ`m`꼻#^ -LM@`1 (KQq尡 #K P4Q`aVʀ 0! `!l!0 d!\!   !@q&X0S7(bX 0!!`a0    !xX( 00  ЀK0X8 吶@卶P 08 0`ᶠ R (@- 0J,LPd#^ -`@0PDP@0L1P0젟&c0`PW1  z<p 0S 5%pW4 +P (p1|<1 V   #P P0P`-#P0V꼻 0-@LW1  <1K0hW^ -@LQT0K0h T0-QL`@\0P(PPE(P\0&QU0Khw꘸] -`pL0$A |P(@T Y "?X@Z7 @HDA@\0PY @T@\0Pu0Z\0P@T SR @ 0S , 0$0,(00(0@\0P꘸]h# -L$M#K`0p000 #K0|PDB (0SD0 P0S^@0K#K`\0aPV ,0 SR$0 Sf uh`00V( 1VT \0P00(00@0 PQP0  0 ܃K Ԁ$Q, HQH,@0 < 7< @0Q@0000000@000(00(0\0;PV (K@`0@`꘸]I -`0|@`8L888(0S\0PO0#90#00 ,0S ,  , 0,`VUH` PP RP`\0KhO 0-@LP P 0 S % 000$ 0800 $<00,  $ ( 4 0}!P0@@0H @0< uO0@ P0h#`hdl# 0-`@LP ~P 00CS0(VO2 @ nP0h#dl# 00-P@L \0"R B C@ U00' 3SH L0SP0\ 0j0P00 P U0 @@AT 0 Sm00<  0CS 00  -L`@P P0  21< 0,( $0#00(,00$4 88<@@HDPHXL`PT 1R01(00S00 04 $ (8},@p v0Hs4Pp l8Xi<`p b@蘸]@] -@L`P0Qp D' P 3SHL0SP0\0 ;i0 0@ <0CS00S000800@P 3SHL0SP0\0 i0 0@ <0CWS00S0XX00400h# -L M`0 p@QP40 ✑. \ PHLQP\ h00@  AQQ8  0 04@p(Ko_\ PHLQP\ h00@  AQQ4  ,(H PX`h# P-L P 0 R00@o0S0 1o p-L MP@`|$K5 KP"8$d$GWM191M+}Kp_L@-|0< b a < <  < AV añBT ñ@-|`<pAR0A 0P0@-|`<pBR0A 0P0C-p|0`<  a< BT ñV añC-|< PAX TX" Ѝ@TP`p@@XPTC-p|0`<  b< BV bñCT ñC-|< PBX TX# Ѝ@TP`p@@XPTP0 H R! D01x0 R R /`Q ꘸] 0-4@LD0SD@HP K0hLh## -LMp`008 < 40 Tg40(0fS00 bg0 0P #RHL RP \ g00P 00S h, BR  R @ <0D  ,   04V V 0 3SHL0SP0\0f0@00 3SHL0SP0\00<0CS fW 0@008`0000040 8 GqpG 40@T@8 @* P HL\P\\ `tffZ`f0`0@ QH LQPP\ P P  P `\  PEZ P1  0@ 0 0JZ40pCWV0T0ppM<0CS00SN0000S000 3 0` pPW 0 000CSU0000 000(00 00(K0) Q HLPP\ P @ efW@f@0`P 3SH0L RP\0 00Q @ 0 0J W1 90 P pG 000 00h#]^ -@L MJ 0K#0 R oi00K 0`( "4`#/-// -LM`p0PK` 0@0 0KT0 0P@ 0 0 000 0?oP20S$K( p-L M|P`80Q03 :@ K2KAK(TKp -wL@ LJ181J(P `PW0SS` c`P HW *J181gJ1p圀 01J`Pc1[<hy J } q{ zy 0 ǒ^ -0L`(@ xPP@ T -LM0K@㱽`px 0޽PP0忽(KWP 4 I/o``" tP@5ԈL l0-SL  $0R ] p-LM0PS  C  0C?S@ R`0K`;@P 0\@@qK @P `Kp -L0 040l*$ -L Kh -PLC2 |2t 0D0:|0x000$00@0t 00 00^`Pk< 0 00040'S0 c0?o0c00400SP :D000 @0KU`PK@0\P:"p'0  t0S q  p  o n m l 0 B :(Pt0S0t0L00L00 <KPp0p < KG `P sMDqz "c-(^^^^#8^ -L$M@Rp 0GS( `1 V Q <0 PP00 (K0P000 040PP000|0 0x0$00(0@0,0D000$0400" 0S&  -`L@t0 CSR 0|P P  0 P  0 0! P 0&  -L4Mp`0|`0@8 ;8PPh "\D00D0 D D0KU@4  z 8PPP# #RRHL R \P   BUL0SC\0P  00 BRCf]U7, BUT DK4KPP00<0K0 0@K8K01 1 PP Q 0,Kp 0 0JPPN <!a(KU 400004 D0 4 D0000D0  0EQ QE!(T哹 #RH L0SP0\ 0 ]400004 D0 <  0CS00S4 D0 00 0D0 T00t0S00  R,0 #^ 0-@LPA0S $K0hB -LtMp`0x *0|`P@|00|0D  0t0 | t h0KTP Y@X 8  " Q1HLP\PPP PEZL0SP\0PPP00PE U!\Z\PEZT hKXKPP [`@`ZX0000X h0 Xh0 00 0h0 W0J! !B(Tϸ|X 8PPP QHLQP\AUzHL0SP0\0   CR $\UX0000X h0 X h0000h0 |0EQ QE 0!|(T凸Q0 3SH L0SP0\ 0 [X0000X h0 <  0CS00SX h0 00T 0 h0 ZX 0F 3SHL0SP0\0=[X0000X h0 ;   AUT hKXKPPCW7@_`?P| T808|0|0V|00E?oT 2R0SP(KU d<  0CS00SX h0 00 0h0 |0 Tqt0X0 k #RwHL R P\   BZaL R0P \ 000B S S[ZX0000X h0 X h0 00 0h0 @ J0 J !x ḷT0K0`0K00dK\pK0 p0 PP QY |0\d <0 000CS0d0  l K  `Pl  `^P,000BZ0x hKXKXPP Z@P 0 0<K`P<0|0 \d |`000CSl K  0Pt0 l  `^`tP#0d0 42 0Rx  ;\ d0 0 0CS0d0  l K  0Pt0 l0< 80 4 0 $K'K'KD QPt \<QP8@00C?o2x0 \d P 000CS0d0  l K  u0Pt0 l n`P# 0 0PKz0Pt0 PY|p0Sx0SX08pX0 0x0 ?o< K2LKP `5^X0%( @ `#^# -LdM``0Z 0`` P\ `(KU$Ht&t00t0 |h0K    `U@T  8   $ Q2HLP\P`` `FRL0S`\0P``00`FV"p Yp R.l`FRT hKTK:`P! ]P$RT0000T h0 Thp 0000h0 0p B! !B(T:0SM]P?`| U808|0 0 a &0F?o` 2R0S`g QH L0SP0\ 0 YT0000T h0 <  0CS00ST h0 00 0h0 TT ? PHLPP\ 6 hKTK`Pu`0K0d0K 0X0K0\0K00 031`P daU Xd |@000CS0d0 & l K dK XK(Pl  \]`G  @Q0h`000h0  A0 A! ት2 0R@p@ 6X dP0 00CS0d0  l K dK XKPlP< 8 4 K( SR00p0 t0D S8# SR4@@AoᩒXd Pp 000CS0d0  l K dK XKPl PP 0d K0XKPKPPpT| p0SYX08X0 @?o< K2LKP \y\X0%(#^# -LMt0S00 K p-L MP@t0S |`P D 0 gKp 0-@D0L \=00CS0K0h= 0-@0L|8(<6H0 001K0h/8]Ɓ 0-@0L|8<720 001K0h/T]Ɓ 0-@0L|8(<60 001K0h/8]Ł 0-@0L|8<70 001K0h/T]Ł -LMP` @ypP K0  `010000 pP0 ဝ -LMPt0S03@{{Xk `0 0`0000 00PS R  )"40 0 20 40 Q,    R  (KQ. \Q 븀X    `Q V: I  B  `  pp ؀H0#[^ 0-@@ L0 0nK0h@P0^ -Lt R02 3QP #SR0|s0s# 0"`p#(Tz""a!"0(1 1yP  0m (KX""0 10 QP Z X0 ba0OQP#SR0s tQ(0 1:P -LDM`0T $0|`P T00T0 D H0KYP4  8@@@# #R`HL R \P   BTL0SQ\0P  00 BRQuJTE, BTT HK4K@P00<0K0T0DpK8K083 p1 @P YA 8D 0 000CS0D0 X @ K  :PP@ O <#N@(KT 400004 H0 4 H0000H0  0DA AD!(T唦 #RH L0SP0\ 0 J400004 H0 <  0CS00S4 H0 00 0H0 TP 0 00KPPT <M8D 000CS0D0  @ K  @P@  P<M?@P@ 0P@PT8D 000CS0D0  @ K  @P@  P<MH@[Y@#^ -LTM`0`P  @_AUT0|p@ZP0,0`0 0PX0 T0 VK&X00X0x0` V0\0 H0KZ@4 x 8 PPP$ #R7HL R P \  BUH0L R'P \0 00 BR'1IUs, BUT HK4KPP&  M XU(KU 400004 H0 4 H0000H0  0EQ QE!(Tz4 0@ 3SHL0SP0\07H400004 H0 50 3SH L0SP0\ 0 H400004 H0 <  0CS00S4 H0 00 0H0 T<  0C S00S4 HP\0 00 0H0 ZP05 P000D0K 080K0<0K00 021PP dQZe 80 D 000CS0D0  @ K DK 8Km@P <WLPHd@ _P 0D K08K00Kj@P0U<18D 000CS0D0  @ K DK 8K?@P@ 9T 8D 000CS0D0  @ K DK 8K'@P@ !x0@P< LHP0,K D K08K 0%@P0P D0K P8K0P <P0 KP0P<KX0Z`F0X0 OoT0BS@T0`T0 \0S`|P#^ -LM0 `0 (P @P   00 `0AWV0 <0 |0@K0 ,,<K=000 0SX040P 0 00 0y00 0SPW+\00\00 |0R!01S   0K 㠐 0`Sp 0 8PPP$ #ROHL R P \  BUH0L R?P \0 00 BR?cGU3 , BUڐ KpKT PP@ =K0 0S @KU,000C00 00S@K,@KG,<K0U00(KU p0000p 0 p 00000 0EQ QE 0! (T呣p 0Z 3SHL0SP0\0QFp0000p 0 O0 3SH L0SP0\ 0 Fp0000p 0 <  0CS00Sp 0 00 00 0 TKp 0 3SHL0SP0\0Fp0000p 0 <  0CS00Sp 000 00  0P P0S~ PF0HL00X'@PKP000\T 40A30p0XP0 0C00 00 0 0C0 v+00000 +  Bp00|0K 0t0K0x0K00 00|61PP Q0Sz t| |`000CS0|0 / l K |K tK00P0 % xJP<  0CS00Sbp 00000   }0K pKePP l `5 0RKt |p0 00CS0|0  l K |K tK0P0 lp0 %K )KL 0 &K+K+K\ QPt \QP@ppGor' KSR0x0 0C?o20 00 ppp p p t| h 000CS0|0  l K |K tK0P0 ml P" 0| K0tK0hK0P0 ^0hS|` 0SWX08`X0 ?oT K2dKP00  U 0S㜐a pUX0%(t |0 00CS0|0  l K |K tKT`P x>IPlJPx5IPY0I 000 0C0 0 00 `R`00 -Zp ZP pp5*0a夠B  ᝡ0`ai*0S] |X0pH000 xHU0 Y0C0 000 R 0 00 0S0Z0SG 0 C0 0000C0 000 `Rp0`0 * 娧P  PY0ia0| K0tK0TKT `PkTJ@K<K>uPxH^^#^L# -LlMx0 `00&|p@p0PL0p0$ H 0p0 t p h0K TP T`X p 8  " Q0HLP\PPP PEZL0SP\0PPP00PE U cDZ\PEZT hKXKPP >H@!ZX0000X h0 Xh0 00 0h0 ;0J! !B(T峠XCH@?P| T808|00E?oT 2R0SP(K0 3SH L0SP0\ 0 DX0000X h0 <  0CS00SX h0 00 0h0 Tp0X 0j 3SvHL0S0P\00 0CZ`L0SgP0\0  0C S CZbX0000X h0 X h0 00 0h0 J0 J !t +T0K0d0K 0`0K0x0\K0 0PP GQT \d |@000CS0d0  l K dK Pl  `kG P*<  0CZ0t hKXKPP Z02 0Rp`pp 6\ d0 0 0CS0d0  l K dK NPlH< 8 C4 @p`dK;(SR00p0 t0D S8#SR4@`p`Foob\d P 000CS0d0  l K dK Pl @P 0d K0PKPPW| p0SVX08X0 p`?o< K2LKBP `FX0%(#^# -0ML00 - K -LtM`0p0\-|`@x0P0x0H  00|0 00t0 |0 t p  h0KTP Y@X 8   % Q4HLPPP\PPERH0LQPPP\0P00PEU# B R4 \PERT hKXKPP" aF@`$RX0000X h0 Xh 0000h0 \0 B! !B(TӞWO@;F`?Pp0V| 808| 808p0|0T|00E?oT 2R0SP(K0 3SH L0SP0\ 0 BX0000X h0 <  0CS00SX h0 00 0h0 T|0X P0 3SHL0S0P0\00CU~HL0SP0\0  0CS AURX0000X h0 X h0000h0 EQ0 QE! >X Y |P8PPPR QHLQP\AUHHL0SP0\0   CR AU X0000X h0 X h0000h0 |0EQ QEz 0!|(T<  0CU0 hKXKPP U0   AUT hKXKPPZt0X P0 3SHL0S0\P00 0CUL0SP0\0  0CS )AUX0000X h0 X h 0000h0  EQ0 QE! ᎝T0K0d0K 0`0K0 0\pKp0 0wPP QY~ p0\d |`000CS0d0 O l K dK @Pl F `DPiU CP QHL0SP0\0 @X0000X h0 <  0CS00SX h0 00 0h0 |0 T9<  0CUw 0 hKXKPP (U0k4 0R | 9\ d0 00CS0d0  l K dK @Plz< 8 u4 r0 $K'Kl'KD QP | ptQQP@ Iop0\d P0 000CS0d0  l K dK D@Pl _>`P 0d K0PKJ@PSP0Zp0 |@ |0S%YX08@X0?o< K2LKrP \d |@000CSl K dK Pl  `C P@X0%(0d0 $2 0R| t :\ d0 0 0CS0d0  l K dK Pl< 8 4 0 $K'K'KD QP tt \:QP6@00C?o2|0 \P d 000CS0d0  l K dK Pl @P! 0d K0PKPPY|p t0S|0SX08pX0 | ?o< K2LKP `lC1X0%( @ `#^# -LM40 1 0000 0 0  K -LdM`00@X0 X0 `0|p\ <ST0 X0(0d0 0Pp `0 P0 V ``V$P0S lc0 N! H0 0C0000 0`C`Z- !8888&`0S X0 0?R:*000H0Kd QT0`S4 r 8 PPP$ #R1HL R P \  BUH0L R!P \0 00 BR!>U , BUT HK4K*PP BU 400004 H0 4 H0000H0 EQ0 QE!(T+4 0Y 3SHL0SP0\0P>400004 H0 N0 3SH L0SP0\ 0 >400004 H0 <  0CS00S4 H0 00T 0 H0 4 0o 3SHL0SP0\0fT>400004 H0 d<  0CS00S4 H0000H0 X01 000 0 000 00 000$0 0X0$00D0K 080K0<0K0p0 061፹PP QT0S\ 8D 00\0CS0 0D0 $ @ K DK 8K`P <AP(K<  0CS00S4 HP0000H0 @ P 0D K08K0K`P00\0 U<8D 000CS0D0  @ K DK 8K`P@ 0 00$08D 000CS0D0  @ K DK 8K`P@ P 00S`P8D 000CS0D0   @ K DK 8KP <iA P8 D0 0T 0CR! S 0D0  @ K DK 8Kd`Pj@^`[ 0 &KU0@S<>AHPYS0D0  @ K DK 8KB`PH@<0 &KP0``` 0 00C S 00  K K KpP  0@S>Hpzpppp00 G J 卖0 0C00 000p G 00 00 0 0 0C S 00  K K KUpP!0S 0  A? P0 00C SST00  K KT K,pPT K⧖ 000CS00  K K KpP PU  000CS00  K K KpP 0@?S' p0 0 0C R  KKKpPp8 S^ T妜PX r ` 0K Kl0S 0 "X001C60 00S K P Yg ,00  000CS00  K K KpPh  0 00C R0 0 !KK_pPRp 0 0 /K 0 300 0K`3P0\00 S00  K K KapP-[ 0 00C R ՘KK&pP ӹpϹ#^@] -LDMT0 `0p0` L0|0L0<$ H P0 H0K  mP0PS4 b 8 @@@# #R0HL R P\   BTL0S!\0P  00 BR!8T;, BTT HK4KG@P <"T 400004 H0 4 H0000H0 0DA AD!(THV3<?@0S0 3SH L0SP0\ 0 8400004 H0 <  0CS00S4 H0 00 0H0 T4 0q 3S}HL0S0P\00 0CXgL0SnP0\0  0CS l8Xr400004 H0 4 H0000H0 Y H0 H! є`<0K0T0DK8pK0` p0  ẳ@P {A?o 2R0S P0SB 8D 000CS0D0  @ K   @P@  < <<  0CX0 HK4Kk@P "X00@?SP<;H@00S=TL0 08 Z6 z3 P8 D`0 0 0C R D  @K@P@`00SR  \L0 vL0 TT JP` 0T  `@P Tg<;(KL0@QT\L0 T L0 T+L0 XPT0T 0` 0  TGP0SA 80 D 000CS0D0 $ @ K  @P@  <p;8S  TKP L 00`L0K -@PL0\ eP 0 00Kq@P0<G;P0,K  0d@P0P@ 00S@<1; ˷@#^ -LtM``0p 0 p<t0 0 CRI)p/l00l0|0p |0 t0 |S00T0 <    d0K [t0PST q |0 8@@@. #R<HL R P\   BT$L0S-\0P  00 BT-6T!(0CSt>pp-@(K, BT| dKTKT (@P# :'T T0000T d0 T d0000d0 |0DA AD 0!|| T(&p00S1:?@p0 3SH L0SP0\ 0 6T0000T d0 <  0CS00ST d0 00 0d0 |0 TT - PHLPP\$p dKTK @PT0t P Q1 #RHL RP \ (B6T0000T d0 &  @Q0d@000d0 p0) A0 A!p p 埒,000BS00ST dt RP S `) 0f00 1aPP 100 .PP 0&T#F$KP0S  K^P0SP0S KPPP0S8:8 (0&^ -LMP@`0` S^T`  ` SW0S|0P0St0S 0 pP@1 1 00000 00 0 p WWt0S 00   fT t0S 0fTĠT Π ᾠἠ(K0 pᾠ -LlM`0P`p7A@t(Kp%000|h0KD \8 @@T @# #R0HL R \P   BTL0S!\0P  00 BR!T-, BTT hKTK9@P  #T T0000T h0 T h0000h0 DA0 AD!(T:|T 0 3SHL0SP0\0 T0000T h0 <  0C S00ST h0dK 00 0h0 0XpK0\0K p00 0 0 @P QAXd |000CS0d0  ` K  `P`  \I# @62 0Rt x :X d0 0 0CS0d0  ` K  ?P`90< 80 44 10 $K'K+'KD QPtx \;QP7@00C?o2t0 Xd PP 000CS0d0  ` K  P` P" 0 00PKPP0Y|Px0St0SX08PX0 0t0 0< KLK-P T \X0%(X dP0 00CS0d0  ` K  ῰@P`Pq夀  Ⴡ@P ,@ y+{q#^#1u 0-LMP|@0 00 ᤱ8@08K0 -L M tQ|@80 ` h0 1    808 0&8@08K ݏ -LMt0S 00 1 K -LM8p PP9/ 00K @` K(K0@Q00@DP0 09/0`,Q1Z`@,0S0P 00009/0,0@`S@K -PLM0,@`A  ?x 0AN1 R`08 0`B`Q0ad0C00 000D3!IJpP8 0 040 00 3!;JP@4`p  0 00H0`00000  B!, @P R0R0080r0cR0a^3\0`0`AV p W(KU ]]A^]]^ -LDM8@%K2L0 L L3008 S 0T0<0 0\%00 46RH0 08 c\5H S 08  ` 0pT A2)A14K b0<"]0PD0 S40%0P0S 3SJ 0SG 0P x0 S ?Z000 \5H SS0`VP 0x xA 0Z0Ct0Z@*4$Z\5H 8S4` P呠 +`0c8呠 Yx``00` ?p`T0 C)C210K 0 b6<""Pxp0u}``0 0c 3#\Q-R (0#S\%K 0 K ?[w`pV?00/ !. 1R R  \"3 0pW``pH0pBpQaq H0Pp H0 HH0P`@@008 弿``F000 lp岿co``000S 00 tx0000x DRa x <cT#R 880Q008qaR0/ !. 1R$K0 $K R0  00$K0D  " 00C 0 RL L30  B 0: S 000? 80L#8202<T0P Z4Z08(KH0 YD H0$PD  D 4Y4P X0P X<TU @JT]^^ -LDM$K #K @?KkvPx40 X \d$Q-R (K ?Vv04\ ` 40 R`pT0p@0 00 Ss`V "P X @(Ko@@#K $K; Q" 0r"000 AA0 L32   \%43R/=S,T @{W04 PuSX0b```W ڨ iW0   cW^00004 ST0TPP101TP 00SX0 s00 00bR!3180 c`V  P vaR4T D D0cQP04 =! TZ̠\K$0A0$0A><0 C 0 @00L3 0  P0D 80aS0P0T 0!`V 9!P 8 $00C$08A>C P?A AL3 0  B  0!000 AAL3 000K\00S  s00nRP #K ?@ $K@ $31@JTU ]^+^ -L4M`p P@?t6up0!$K\%0 R 0?!! ?#KT80< L2)L<0K b<"1>[P 0` 00\ Ó\ qW(KZ 0  `$Kz0XTU p-L M`@PU Kp8T L\UP!P TU0PCP -LM`@Pp 0T  B bȟ"30ᯤ0 0C0?oR20S $KkE -LMp`0HPS`8@ 0 0K 0t0 QPb 0p(`80 00(`` Zf k  0 00C0 A`Rp`A L32  B \%X1R/=S,T @U0PuS X0 b```Wڨ 4 U04  U1]00C00ST0T00 ! B !0 0 0@P800c#K`pt` Z"P0 0S@P(KU T -L4 `0pS7 00#K ? $K4 =S$$岺 K0w0p0 QP405005 00 080T j `p 0 L30   <0: S 0?0C0 `Rp 0 L#00C0TQ X  0x0cR1 (Koz@JTU ^]&^ -LM0 8@ 00PS  A0 T_!$``0 C cA>2 C`p< D4@Ĕ#c 0q 0R0= CP0 00 0S ?q000 凼P ?gq 0 0 00000 nP00Ȅ0Sh0h !`a 00 00(K0 =^N^ M -LTM|l0 h 08d T0H0 ; 0 d0: SL0 8@,0[ D0 `0"q0E q0PL0040 T Ӑ,`{0 00 V-Q80` ,QS`p?pH# L0 PS0@3@@ 0d0 0 00 l0(KLr P0XpU Lb ^pX`U ? 0p0 00 00Q0C2S0!XP0 00C1HS0UT0 00C1ES04`0 0Rc4eK@0 @4K 00`Vp?p#KR0KeK0< 8 V" o#K0|p@0PSiUP0 ?ip0D R0P"0D R240P64`00`WLP"\T Q  `RH# R0`B0LP"\ T Q `RH# U0L#" X0L34 20X040 cS/ 0C0,HH h X<≷1@ PR@0 YPP1ꄥMv^^ -L` Pp8@  h`0 C c6'`p\ SQQ 0!JPRt V0  ?o8 ?,`pZ 1JP ?o ?o,p&Q` A?o0"WU`p;yL Q8 `p0L320S80P80` -L` Pp8@  h`0 C c6'`p\ PQ 0!B0Vt V0  ?Mo8 ?,`pY 0剑 I0 ?9o ?C< D4@Ĕ`p#c 0l 0R0000 P TV) 0xy\%0R1'#K#K0"K08 4, 1KT0L0 .0SBK ?~l@ | L@0 8`2\0 0\0CP0 L3T 0 0PQS:= CP0 0 ˡ0S S< RD4@Ĕ# 0PlAn FP0 80S ㉵00`40K000 0 0 0DR0PD0 D(K08S <0Lʟ0 x0 ?x(K#K 0R ? R00T0T0 \5TS@00@  00@  0 L)Lß0K2 pb<87"R0PD0 00将0p0S 3S6&\Q-R (K ?k&K 0Y`?T0X0 0S̠ &K ?'KZ[ ԆKx08@(K 0&KQo A 40Z A0C4040T040 0TAS&K ?$KZvTQ @0@S  |0 0s0cR1‘T50NP000S h00h0 00 00S T8`4 A\<`)A lQ6^#LSR| @'K&K܆K 0'Kh0/0 X0!.&K 1R R P"M &K$K܄K 0&KH0/0 X0!.$K 1R R ^"r nH0܄K/0 X0$K1 R0R  0( $00C$0 ARA\ L30  B $K 0$KY0P hMT\!`am QO40P 0 0Rl40H40 , 40 00S0D0 #K < D4@Ĕ B#d 0jA~ GR00` 10S 001` 00@0 P0`pR009S 0t0S# 00#K,P000Sh00h0 ! 00 00S! T04 C)C2 b16<"# N40 00 C 0k4040 , 40 00S`@ 0\4L0S 4L=^N^T^B]^U @JT^K^ Mx^ -L@@ #K@0KO`P 0h 00Q Q K(K 0 P #K%0LTa]^U ` -L,MPpḠ@ ?bi|0\Ŕ0p0!#K`0!\  ? `0 c0# S.Q,QQ3, V@@#K0KJO`P 0h 00Q Q K(K 0  P p#K0BLTn]^U -L M`pḐ@ ?i\ !tQ\ ^  ? `0 c0# S.Q,QQ3, U@$K^  ? KT004  A0)A1 `2< (KNP(Pp 00P Pᵏ 1K\ ?h@ TB@ KTU -LM|P 8@8u Pp2 a Q̎SQS10 \0-0 UQ 00 sS %0S0 0+KR0 P l0 L1<1̀ 0 ,K R00lK00 +KV0000SI `p<96>Q,P850%00 0@50L5 0 SY60T0p00,K0K0000000 0,K[P P B2 b061b `0`0*z0*K' 00 00S  |K+K R0 KЊP `L<6 l0>,`B SR0S68Q,P85L05܀%0@5 00X00X0S9 0T>0(00,K0K0000000 0,KPP B2 b061b 0`` 00 0 0 00 00S P + H+K R0kK P`p L< l86>, `\< SR@uL08E @@p@pT0Sz 00@0D00000000T0(0000+KZ0K0000 p@0+KsP"0 !SR0@u0ppL0p0T0(0000+K40K000 p+KdP0S 00 0pT0  C)C0 `012< +Km0K0|0K0+K$P(00C0 t0 0aVg0pTi+K`0K00 p 000 K00 +K#P0K00 000`0T0` C)C0 b2160" &K,P4GPt0 0a 0 0 00K0 pЀ |K0K00000b0 IPy000 00 10 0W 00 0S F0p0 0p p0 0K0 0 -K㺅P FO0T0 R 0 00000+Kt K-K000+Kj K0K00 0000-K +KP0`00 0 0K00 0000T0 C)C0 b201<"  P E00 0S0`pK0WE:V h0dCh` FP0` S0p0 |Fwp<` ?Kp`T0 C)C210K0 b60" EP 00 0\%`0PRx 000@? n_ KaX0 B(Kc_,Bp TT -LIM.K0 0 0t-K A0ASR|@:.KR0*Q Q^^P hQ KQP% 0၉Q(p` 0*Q  00 00  (K!)KQP08P =*K .K000 .KR0rP \>, l QP!Q RQ<Q` l \6 `Q^ Q^SRD K= C0H`KWV 05 OK0 V 0000 0!P 00.KUZ .K 0 AK #0H00,0,0  A?K  ?.K0 0000 .K R0s!P.KRt0S G.K*00SK0.Kň.K0P ?`Rp `60> P0 W" 00P0 1E?K R08# 00 0000S0 GK-K 0-KZ* 0EK A?KEK R0q/0 AKQP `0S1{ 0!C?KC?K 0 A?K R0 Pp 0n1 >p N:.7:QPb:0.K*0S.Kb A?K R0 P pL< `l7:6,QPQ:0 RU嚥08%1 "6nK60K0P00Sg 0qP  \2, 0l3 Q0 R9Q0 U0S<0 /K R0 Kj< l90>,WVb:01 L lj0&jn<0 0`j>0 0300 0<0 /K ?WVp1`1.KWV`pH0C20000F0.K@0d$ 0`p0H$KnK4p0`KV0Z%0'00/K  0P a0 0000 .K R0SP R8@eL`0K0'?1ptx1 ` 01E?K R00#SY 00 .Kᇆ.K.K.KK* 0 R K00Sh  Bh  ! R0`pa 00 00 RN !G?KG?K 0? *IK PE?K  0 L `l2< 1 CKI?K SR$158e50`%`0@55`0L05`009S t0S00 # `G?K t 0 R  p!pq-Kd KE?K  R0q1GK' 1CK' 8@L!8% @ L `NVd009S t0S00  TC?KR `0 )-Kd KFYnl8^00S1/P11/ -LM|@i8PpV``P (K B2>0`` b` "<1`P (00 0#]9(Sڦ>` K; -L8p` <@00 $` B2 b>51RT H B1) B a25>Q@P8PD0<00p0!"000Guo;P< -LM|0P8`hpl@T 0 @p P $KT 80 B< a31< QR0QR!` a31 Q-/ -|PLծ0@ `VV ~Ѓ08E. `0 WVE/ !SCE?000V `S000$Kk\ 0 -LLM@ <0 哮0L @P`00< S cQQQ< R0T0 HFP4 X100H0 D0 p0%K0 @P0 T`c 0 X80 0H 0 R !01'u0`0Vb X0 0 R@ @<0 00d0Sh0`h` !Ɵ 00 09S`L0iV 8`001ooT.b(K(P  B200K 0 b81"8`P 00TW +t K?\X000D 0&KP0Q&K 0:sSR.H0S ޠ X0 0 R !1 00 0 @\ 0 00D 090Sڀ;0P S C:; X00:@00<0D 000090Sb;W";U X00j:W080 H |`PH0 wp 08q`P 9SL09S 8`8Vc0P S0H0 I^ -L 000=C ?;VP0 C c00 4 K ẃP l 0#K4Y  0 p 0S2 0000`8 ``L00L0卍408 1H0 @0B20I> 000=C ?UP0 C c0H08 vP dԝV 00D D00p00w000c#nn^^^^N ^ -`0Lp@& PU 000`V t$Kkw LR000 0p Rpk9S000Bj{N -LdM``0|@0h 8P00p0  " *$K0, K0"d l0 h0 R Kh0`PP0K0<P D0 7D0pD0 D0(KT0<ĕ8$ Cà c23@ D0 P00@ c6 SWQWK8D\` 1eK!lV C dK\  c0P T KQP::8"3H L0 $K ?WV*L0@E@DD0@L0@d0@ 0l0 0 0;P0< 0\@D`00S`00DS\0 0`0h \/j0P<\0 d7\0<0 ud ,0K @# l 040K  0 @ 0 ; 0-@x L0P?T00S V0 ) ) d l p t000,V0 ) ) X P  0 -LM` @:P P 0 WVc0S 0$ 0U 0 #R0PvPP 600KC-8P`@@8 ^ T q   Y | pሀ8Y]]] -`0LS`5ND5N5N5N@o10 0000000B!000!Ü2^ -0`LQ5N5N5N5No0! 2B1   P"垜W^ -0`LQ6Nt6NX6NL6NBBx^ -0`LQ(7N 7N6N6NBBR^$ŐG-\LRPPl@p@`rpnRSNh$Up`Y!Vࠡ΁pppΡ~ ^'pBW  ‘ @$@N`GoHV#pG  UP!W !! B!^!0B1$5S P#1Ѝ Xppppp  H @D!R0C -L MP@T00040000 0= !`0 Cs cpcA>2qC 0#KT0PĔT$ 0C cp<` ?Kp`T0 C)C210K0 b60" 8pP, ` S8@ "$K# Q$K 0 040Px040|`00d0L0 0L0(KT%,%] -LM4K8  -T#KP8hpP8`|@帩Zٞ|0P SՕ ѕp(Kl l80K  &#x\%H0R,5S0մ Ѱ ն0Ѵ0*8l|00@@%$%(%T -L\MH   0 D3p Q0 `PD0K0PL0 $KH0PL0  $KP tL(KH0|@9 S Pl P PԄK` @h 0A@ 0hhkAP^ 0ah0S^0s0#0%0%*|0000 Qt  0 XQp  00 %XQd0X00YPЈYX Q0(l!lH0K  w%~w0 00 R l0P0\%$1R<K \#K#4 0L *H{00@@y!0!0 $KP%K0X0 l0P0P h@0 0%Kdt;00SH\  0!Q t !r@]]^$%(%T^Z^\0@-0 :B S60B034AQ\*=@C0$0S# 0S 0S 0S ,0S \0S \Ő0\x0à"ĠR S00 \0P S0 00\T S8@^`\H|L|R3ST0RS 0T -PL4P@X 00\ Ó\ R1xN10哊%V<K TU 0-LM p0Sp+@0 00@@ @@@ΐP0 00@@ @@@T0@0@ @@@0  㳐K0hK0费^%^ ^ 0-< Lp00CSp00$@ޑܑK0hؑ괹% -LLM(0PP T Y 080 ayT0P 8T8Z @?>L0 0h/`?p?A 0$40K04+8W40PD L0 A~4 0P %L04! %05\%`0 RR  -~0(hpVW0#03 W0S P  ~0Y 0R$%$5R, ,0R?>`CL3 L3P3 P3H3H3=0T3T3O  }08000P<0 ,(5 0S,0 @0@0,00T`FS> ) %< 1S (030D(0sE 0X4S 0 0X4d8p40pA6LEX$5SP0F0KKp 0LPP sPxP8 gs00J`800X40`H` ?$KT0HL C)C4KL 0b03"`830Pp4 0 L0 DOL04/80p$%!0, ST0P ~SP |`?EM%K̟)# ᜀKH00H0 ` \5S 00ß0 2",0KKKx ?!M`0 C c0"3@ D0 $K ?KT0p C)C4K0 0b83"83P r< 0WK<0(K# 4 4f/rM ]!^TT^,^0^M^ -LLM0pR`@00 p0Pb08 X 8l`0 w0 @@8Rp8KW>(0|`T0 \0 T0P<0 圐0P  /000 @t 00K00T/  0:$08?2pP~00K0 l\5S(hQp($KSRp 8&VJQ |@0 0SN %h!VQ % # 3 Q RAP j|Shp?.B$KSR@ 5  (07<0 O $K`S> ) %< 1SE 0X4S 0 0X4ph00 S.0800 0P<0 0L0 !=C P0T0L C)C0K4 0b83"8$2pP040$ R:|.L000 L00 5  0L0S000004pA4$%,0P Rq0T0 {0H0 E>D Ld0 H0P Si$5SD0P30ÜD0, H3CM4tS9Ӭ4հ4S@0Ӱ40T3X0`0L0,000(5 0S,0@0@0,0P000 040(0:(0,0<,0X0P0`0 0800t0D0t 0b0?o0cH0T0 0CL080P00408088L0SV (pu 8p(K(0<<820(020<0 pV00H 800P S0H C40œ d0CH0ßT00K C)C 0b"838e1pP000 0D'MD  00D0 -H 800p 0H0 ]D$%0 D , R^\4S  5  0 00(00 (0pTL!{T h{8㼠0P <-V P  {\m{00zp:<0 Cp0a`p(0K00$p` 0h0+`04`P2Tp(0h 0*L(p0 51 50P0\%R=S04, 030304040 50 L0" " 20X-` Kc*T -L <刐 @@ST]@J^^X^0^z^^ -@`P1LPpሁP 00 PB=TpSLP 0 <= t0S Hs= S}.n$%0,RL1FxhCxP >x7x00(0:(0 -L$M@pP=S =S 帐4KUFW00W`0p 80 0 Kx4|FP:4]FW 0j0T RlX Wr ~P`fTI=S* 000C^ P`(K8r P mW0P`m 0   }[H]^HN@J 0-@` L( # T0|  Q  `000P05/-/ -LM|@p #K0 P80 0` ` ( 0 00YS*9  0 00 =P9 ;909  0 00 -P9 ;900X 80S@@0S Z `0 }00p#K1/ H@RP@ (K0X } W`0 0 00(Ko/ -LlM00| P0 *  $K04& K*QPi$KR0K0H0 )QPvH0SHX dK =T0 00L0 `08(0H@0`0 *#K= C#K ?%K#KR K0 0K`p< 00pH0`K#KP0fKK#K 0'K#KR0OP4p \7,0p `l&`QV.Q0 R^<A l0l \nQ|QjQSR8 K#K%K0 KSR#K, qKL0 0P00#K R0 0k pPL0S #K#pHc0 %K#K 0%K ?~0S)T0Sp H p`$K 0#K#00 H0 0#0  #K0 ~p  ) #K= C%K\ <00`0`F0V`!V #KKR0p#KKpR0ppWL0K0D"0 K 00\ >0P`p#K 0%KK#R0 0opWT L PpP; H0C2000 0 )#pKR0 0pW#`0S`<0 #80 (CL8QPT 00  0 #K 0~pP? H0p 0#K P0 (KZ |'KP0 0L000 'K1/pTW ! 0-L @P5 P000K0hd -LM@|Pp|9S ʸ;S ` ( 0 0`PQ 0 SL0L0ڈӑ0|P|0 0 ̈K%%%-/-/-/-/-/ -L|M|0@ p0 0p)UT`)P& p0*UT#*p0, K8P00"t 0 ^ p0*%K %KK%K R0R'K0 <P _' =(KP\X 0Q0 a" QP3QD D0 UX0S1@0 $K 0&K`d#K A" 0a<3H0 1L0 $K R08ŕ%K܄K SR4:0@\00 0@Y0 1܇K !0X ܄K\ %K SR't0@000$K*P<0 @D\ RT \@ 00 \YP <&< T0 @@5@L0@&K R0$K 0 A a21l0 h %K܆K SR*T0@ 0L t ,0K # 040K  0 @$K* -L$MP`t |@R0 p0 (Ko")QPB0SB 0 6S (Ko*QP:  (Ko~꼠080 0S Y  *$K 0#K$K R0#KQPP H0 C20 0080' P (K -L\M`PX0 0T 0|@H0 0)YX R 0QPH0SH} T08P =\0 *&K0P0 Yd P Q2 aS8 8̎SQL < 0< ULpA W p!Q`0KӜ Xp  1/P@ ?*QP 0* 0 R=* m0P0 #K R0#K P 0 l Lh h$P p>(pB Y 0 P0܆ 8[ >*^h`_G<%@%D%_0@-0S  0S@@0S  0 -0Lt0S 3^ -0L|  Qx`F^ 0-0L@|P$PP $P$ 0 01K0h/m^]Ɓ -PL`h|@0|0 PPPE PU$ P(=p 0 01Kh/0%]Ɓ 0-@80L04$  0S0K0h"* 0-t LR R娈|P 0S80$ 40A00"t !4!S0P00S 0 8҇0H$O┎^^0% -L M`p|@2렀${OPPm0PP1 EPP$nOP TQ[~$00^ M K0%^ 0- 0LP t1*\Œ`\00Q0VQ08LP<<80=40$0 @0蜺^Tp'h`_@%'0@-@P0 P 0SR00G- MD!A`0Q000o0@$@TP%P`A @TP@ @Hp0 @C c@>T @@@T PP@ ЍЁX@PP`@ P@ `` AaUT# H`@D0C4c@ c pSjTgQI AAB_ CC `cJ9F @C@``VAp@TPPA Q -LMP'K|`0U ` p0 @P  000DsH0@0 ܇KY X 0ZW00 0R|  1L `L l<,60> \HP pP`P 0 00 (K07P| x0 0L @ `20 0000`pY X 0 S0 !1| 001/P|Vl`KWppK'K0P0 0 Qp0 0> 1p `p00CSp0 6W  0X &000R00S 0P X0L! A a1<80 00 6SP|0cx0s#L A a1!<60 0z1Ѝ!F)K K'KSR 02 W>000000D00)Ky#pP -2L0 C c38008600<0u2t20t2TP  _ 뀀 ;`Q)K- H0SWL 00Pp .RQU 0KK0D P00 S 0|0 !C1!01/P`H'K 0'K000RЀ   U R 0KK0D P00 S00| ! A1/P 'K 0'K000 00 U 0S `pY X 0 S0ሁ1' '1/P 000 -LM0S |   0S ,   0   C KXN -`0@00L|P`06/ `000`06/P b00 -LHMp@%K`0K00s #R 0|4K1/%K0Hg#K0K0K" 0 R &GP :D0 I6@0 $KP0KD0$KQ0)lT0 G`K P?KKᆉ&p100 0@$KtpP ၉l$K |0K0   $K1/plK|0, K0 $K 00[=0[S< [.RS#SR QP00; [.R00S P -L\MP2p0\0 `0` 0@\0Z1d0 k1P X0 j |0T 0 4 K #1/` d 0T1ZQP0 DC 0d5H L d"83 @0 4D0 ?&K\0\#KDKK@RPP &KR DKT !K@PVDK 80K0 0L 0T000P000T000P0 @P0 0 08 S `0`F`00`0`0 dPjTXj(K蠺 -LM `p0|@l0 0l t0 00d0 `0,0P0 0h0t 0h0OoPP90  `0(0 0JSPl00H0K0000 "PH0 S080l00SP~S0 8000 0000 R00S00 00000 0\0 `0ZD00C0 \PU ?SU .:P0`P0 @0|0 `0 0 d00C x0 ?)K܉Kd ? *K:d00 0h0 p0 `0 `0 S0S0`0\0` 0 00 `PPx%0PKP Pp640 `0PP I0` PK00?PP (K\0Sx00Sh00h0 P0000ഐYb % R  0 P0W \ R Rg | R      IRڐ`P[\P]xh h R  Ap R R= | R  R6 0 AP0/| R@  R=d0`p 800`0 0\0 PP 0S| Z08S0S u@$`0 d00) I I )` ` P  ` 0S ` 8  p \   dRK`0 $`0| `R* SR *\#L00S0s 00 0P~0S Zyd0`0c\0Z00S t mPP)%KK#K#QPP! L0K <K`f`PPL0l 00S5 9S2 t mPP \0S iK*K`p8d0`0 `0\0T0Z`x000HT x0` dP!d0X0p0T0`0S0`0 ZZ 0l00 "QL0K DK``PPL0K 4K` `PP9ZK`x000T0HT%K$K#QPt^Lp t L`TmPP9  |0t 0 t9P{ P4^ZZ%KK#K#QPM^Lp l0L0P00 !{\0^^ -L,M@0 `0|P,p0 `<0 0@*QP  0 R8 00 00 040K000K0?Po0@080 pW Spppppⴠ0J Z<  R R) <0 !@P<0!pZpđ$,,匀0p p W0p 8  Rppppp0C D0 9D0Z0đpɑ80S0   0 94l 0P0 0 R ?SR *`@ 1/ (K]^^ -L4M @Rp0T`0 |`,0刐H0 0L0 0I ,,$@K0 R P?5/PP5  ?*\/ 00 0*aH0崐@0 0 0 @ D00C00L    09@kP<KA`0< K00@04/UP(K!0 P]^ -LMP@|` (K,0K. 0?pP% ,0,0 T 9 0C8C890 00 0(ck 0Tp0 0 0 9S`00003/ K0 B?pP ,0R     -LMp,K(KP@ `P%(0`0,0@ (0 9 0C8C890 0,0 0k 0 `0 00 9S`00003/ K -L@M K  40K K] -LM|0#|1 K -LM|0|| \ |0 00 K -L$M|@P)|@`|@\yᰀ @|@@H@@ p0 K|| 0 L -LM||)@0C K 0-@LP0S K0h p-L M`@0K0! 2PP PP m|T0 00 Kp 0-@L,`|0*0m00 -@0 LLMp$KPP [l|0`#SR[0`(K0 00` ` 0D KP `P`0,0@2`[1`[V `[P3[ S0|8 QP$K6m0P@P0K LK(]X [X0SP`@P Pr[PP@t0S x[P|0*0P.. -LDMP| @ <0 9 @`Sp0t9|08 )0 | 00 0 `000p07/pP080CoᩒZ VX2 | 9S@09|0)0 | 00 0 `000p07/pP | 90C9|0)0 | 00 0| 90C9|0)0 | 00 0P4 x |  0sp4 xWnXZVP0 p 0 G 0R0RQW W R: `00 00D0 0,0K #000K 0 ?P& 0p@0 0080 00 G 紐R`< , @RH0 <0 <PH0 @  R BR4)00<0| 0 tpP V|009 ?o200 ~(KXg | 90C9|0)0 | 00 0 `000`06/Q80S0 X 0|p |09#60p?|}pP4Z Y; | 90C9|0)0 | 00 0|9S !0| 9| 0`0@ 00 -  01/X 0p00p0|0# |0 0|0@0  D80Sp8 I0 pD00C80080 8 0 ZpH%^ p-L MP @ 0| `P |09SKp|PN/ -LM0 K @ $01/P00K 0-LM@K a0 P[PP^PP Y00K0-/ 0-LMP0@ K $ 1/P PF00 0| Q  Q Y0F0K0 -LMP 0S 08 00 000  Bu0 K診^H%/ 00CS0/0v꨺H% 0-@PL T 00 -LMp00K00P08 ` 0`n[P0F^P 0#Y (K000|@ 0 0 009 R0  09  <101 00+t;0  ~P9 ;900 0 00Qd0X0 0`000`06/P ov` 0 0 8Y vZ000 0 90 000 0X@]H% 0-@LPG0S ≕K0h p-L MP 0@| 00T ]`P0AjKp p-L M 0"| 0@0T E`P00 0| 00 0#jKp0| 0 0 @o/ 0-L0S`0|00@0 4/0 -L M`@|P t R02& `0(00Q t  $~ptP2 I20@p!+(0 ~ K -`@L`0|P00p0 7/"!#"9:#:0900 000#"00St00C=S70(00000 ?#00@00 ?$00P00 ?%0 $0`00&0p00h0+40 0x00|0t0S; S8`0D000t00$) 0(S 00'Ñ(0"#0D0@00"$0@0P00#%0H0`00#&0L0p00!4;$( -LM@0S30s0!p`SR*bWV&00s#(SR0sx0s|0P s|`0T$: ` (   (K 0# #88Spp 0t~0 C}PW0|0#880'00 Rd0X0 0x#0 0|0 y0s+ `0(|p0y s000 0 0l~ 0  }P00 0 0R0 t   尐0 Rp 00 00 QP t00CS񟗙NNNNNNN`0(00w 0Pw#SR|`1QP-&SR)pw! `0(0_0 T|@p+t}0 |P 9z:'zp 0y0 00p>`0(090v00 ~0 @|P*#SR `0(0 00 0$SR 0 ` ( 0 0&SR Q#0p L `0H 800p07/P -@ p-L M@`t0S | |0|l0 0 0T0'PwtT+VKpP3V -LMp` |000 5[PP ]gSP(K|@(!9SLgPg  AgP0 8C890 00 0`000P05/PP os 0P 0 TWP sU 9 0C8C890 00 0H% -LMp @P|TT T, T4`000S-@$K贐 1s`@00@ 1  b(1 00 P0 @Ds 070 g@Z K0hm% - H@ 0D`L0C #6RPp`V( 01S P f`0D1X  Q R 1P S`0S -0L@ Kh衴]P(0`S, p, ,0( 哴0U:00Kh0! 01  R` `1 040 ~P% -LMHP+p0S(Koe0 0 0S? `3S;#  #   @P 0 0 0;YT ;T 0000C0TA = < B A Y=!#A #p^^+ 0-P@ LgYP$0$00 00 $0CK0h -@LP`"vᳳ$0S000  KhC-p^@ ` @` R(T P^  Q^P"*P L q!HR  !  B   B R   -`LM@$Pp T T00@ 40  00K4 KT(K80K< K800 S `J0< 80<  0C8` 80`@80K< K800S G 0< 80<  0C8 0< 80 P< 4R0 <0S08 c80@ -LMH`z V@u B3X:`P`R  \ #\PRP  $V 0S* 0S  $  0D @PH (K  B"P0S00000( PP 屲0Sp 0000000C0D0 011 01S     0  0q000p W  B!)00CS0000000 $00Cs00K0 0D0S A0Q$ 0HPD0 -LMP0 0 $0@S`pp$Aq 0K0 0 K -LVT0 `C0a@0 0J\80D CH0DT00 -PaL`Mpᅰ@儐K0%T00S彰$K,0TPKX0 , $0K8@#,0(0S,0 (0, K, 0(P(0 P^\0S,@ @S X , X P0,0S( , ( 0ꍰ0SP2凰PB\0,@SX , X 0,0S( , ( 00! 0 R00R0S000P 0000SUP0SPP%0 ! 0/-@ !! m' -PSL`@!V 01P 0 ͊ 0a 0! 0Q000 !  !AR !  B / -p@LP`Ὧ0 000Kh[ -@LP`᪯0S00Kh6S0000 Kh= / -D ML 8 0 *0 0 00 f KhN^' -LphP00' h' -`pL@T) 3S& 0S T 0SP ߯PPጯU0  0S 3 (:30330C3t+^  -L`` P P% p#  PP @tM0 03`033S8<K3 03BT >+ 0-@ LP0MM0 00 -@L`T, 3S |@P& PU ۮ30C300 0?ᬉ3 03圯<彮8, 0S崮 X00CX0++l* p-`L MPK%@T P KpP0P0P@@# P 0-PL@3 03<@~E80弮帮Q00K0h+ -LMPQ  6 K0s/M@-8000CAT <01D A  @_ @ !R`UT !0 -L M80PJ#AR0<0a@D@Ab A 1T-X00 7 W_@P`.  !00 R !@ A@ 0` %PQX`V00C00S0S L  ` WV @V000(K`@, -LM#K0P0@`p80 %@51s #K17P40#00gP#KHP 3@03303``@⁣1S 0V #K*0#K`80V#K6@P-#K@@P ɭ:僭Y 3031S40#00 P70303g3@03A303A 030!0 0咭  KIY 3 H PK86vt303} 0T X#K*0#K@80TSY0` (K^^+ 0-P!L M`p&6:'fpH A 4``008  UP  Z ЃAX H( 4 I/o0 KXD0"K4:HP@< U80080 0 0W  Ƭ0P Ȭ@1@ASH H0L L@@(KZ X40 MR404`@008`H`,@Z?RP< j)^(]*@,-^P/ 0-LM\0\@T LP\   @A~0 0,0@@0 0X?\K0)@,)^ -L;P KhJ -LM P40@, 3p,c 0 K  0 0# 0YX*i406!:& KR Ơʌ`A ,Ppp  o(K 0p-K<W9K4K% 0h0 0| Kd0 h0K 0 0`-K P0E0 W |0KVs 3  -KP000P 0SP `-K`-K-KR 0-K\5-K*0PP-K 3$ W 0 KP 0 0 0K03,!03000`ϫW 0Z0 00-K*R0-K0S OOLOLOOO崫3S&50S㊆(0,#6)H垫e588ih0d S  d 0`2^u^+@]}^ -L@P M$ K@"ş 6, K  %:&p, `mV V v$KD^,3S5(噫,3 X, 3K03+ -L,Mp` KKCAT ^D  H &".C280 40< 0 #2>D0 B2@0 H0X Z^ |$x!pX0 CX(Ko^@0AT 0KL0 RPKPPPUKSRPKSR 40Y 0S0S   ]L@1T0 P P CIT0P  00C0P#KR0CKƟ`FX0< 0P(I(K+l*@, -LM0@sR PN<崪H000aSL (qL $ 娪妪PU 0 Oܪ#AR*D @;F.XKh$Pk3 03ª0 00wu(0,#654<PK@-+^ -aLp Z@AT嗪lHPU ኪF#AR0CD R@00S B@ ZW\ Q00P `YX U S<0!Z00W0S #X0wP @U@,@- -LLMt$KDK` a0?P@DKLTL0A0A80 0S0שD0#v&t804 0AT<0@T 0PأPDE3,PXP 0 0 0幩3 0 <0 Ɓ<H(0S, , " 80S< < # $K 43`8 4 !( R8 4 !(,8 4 A8  4pq,p(080S(08 < 0(@<00"S040Q<400400 080000000000$0奩 0X K0 >0#600 1<0 00M0 "KL! 0 D  0 01 D S< A !0     0 K %K1/pP800X0 00WD幅 00 00V KQP; (@A1 0B!5D塅 Р80(K#R #R OY 0VD刅0O3,t5'X0 6L0 /0 L嵁p0PPDE3,PPQ- *[^ -L4M\ 3,P 0@Pbs3@ C3RK !#KK0"X 0K 0K$KP 0l%K#K$K R0" 1 00M%K0  D0T  00 0偨0! D SS:幨1؁D  2孨X唑g0 !0000CS03\000F D0 VX!0L0 0P 0C3>0CS0000 00KȀVH 0 KD묠K0UL 0B?o20S V 1S 0S # P 1 ٠1#RJ*,  UW 0 0 P UlK 0 zP0Y !R01P010U X Q 堠E*ޠ  0 1 '0 Q[0à Q 0v0}8 0/ F0 `3S 0[S000  0S0Hp P` K vlq-0[S* 0S'0 0K,0K KP# K rp P0pA)3A0300C00p KKj0000 S0 0Ã0 0$X Pl0K1 UX B 0 K  P!05/ PDw/P 0v`6 1 0U0|a10Js60U3 32Y/ 6Q@ )0Y003030000[1 Q 0  & 1  vP1H̠l20l20b0C00`00 L0p K1   1  00K00K 0PP  01/P #Z4 0/ z0S   B  (KKLY``VP e0 ad_(T坟03 V 0DABP K_3 J3 03 000)zU U P 3 RZ?P0KHp0 0KKGp PU0u`000 0000 y3  3030W 0"  01/V 060 0PC0P 0 P0TrH01 1Uf0 , K!@ rQHK PK #Z@ zB F00000 0"`0p0@ppL V0 K1/ R0,K1@ 0, K1@P0[ S00#10U0K 1!h20h20[ SX00000I 000 3S 0[S000  0H`PP3 h3K 03q0d00i+0 KK$0P0KFl*^^]+j^t^^]^^ -L M, K@`6 pPP(f\ 0 QR,0 S U eM,:,P( KxP ,0@0Sz(%P 'JT,05 3:U C,+ K^+ -@P`L  Kh Q-LPp`0@ST`# * 0 `P T  JT 0 غT0 +غ -@DPDpL`t  0  @l غ -L.  M   K0.    R0-LP@ 0D0 K0h.DGD -L M@%0 1K -@0ML040  0  ; U0 K谺^h* 0 KVh* 0 EVh* 0 oVh*// -L0LpD@QD0L`S`yD0D00R('N<'0 0 0@  0 `p PP ||Y0@@xU@P0  00 0P Y K]U__ -LMT1p`L10PP0<<@@0AK0 1 @sp#KT0 fW5 X0pCXp(KoZ*0#K 0~$P 3 030 00CKCK$Pp$~X $ /(K+Ժ+_[+l* -L@M`ሐV:$Kd0K!tPpZW@@U@#TE+td`KW`Pp!$@[ -L. .M   K . -N@L`P@ U4 Kh  -L,M@P000 0h1^0 < <N  P 0K P)0`008P Pp5ApF@0 80S0v0`(K0  " P@0S 0 0 ` )P LL'3z036!@0<  s80j:C80 +Ժ[_ -NL$M@00KpFg`P*080 A33p0P<0 W0v000<0 00 ! P80S l'0`0 `   0 h(K3zG03 @0 rZ[_Ժ -P`.<0 N@L  0av KhgԺ[ 0-<@LP0oiPki!P3#0Ժ -Lp`ᤙ؀ؐV$Kkޙ@ 0SP!PU# 0BQ30S 3 B0#33SQ0SE#U ẙ`FPP0 8+^ -`pP㰀LU@A]3S 嚙@#T 0 0pᏙH3S$t303"{P+ 0-PH@L000   0R 00000l* 0-L 0@W0P(0S " K"+ R0-L@P >U : K0h -@LlMp h `0 \0 T(Kp0@@ 0@ H0 h0D0 p0<0 <4 KD<PHK<@\0` S 0\0CAD04`<l0 l  00C0 S00 500$ 0d X0  yd0<0 080 00t0 D0x0 H0S 壘\pX0t\p &l0QH0S טHK<Y;S` 40xJ|PPY 0 P 3 Q 3S 40$ HHKm@Ts000PX0p0X0 40 HHKP y #Y44 0/$ X0Sh 6@D0h0 bPI3S 冘 403Ss303!vP 0S pd 40R $PH%0Q @40P L "JLK PK 01/  P[ HK40L  J" LKPK 01/P #Ps`2  ` 0/ HKXY ՗P0 PїP03 Y 4D0DAP HKP3 P03  P{!XZ Z 01PK7PP00.ꚗP!,ؗP 3030 = HP1剗X0 0 0=P 3C003u 峗0l3x03ᩗp0妗\0塗 HKUDl$HK P U Qd H꼻_+^3_ -PL4Mp#K0U`sA0,`K0CS00&2&0@ Kp 0  00 $KԋO9_ZO_ -@LMpKP` `  K\ 0p 0 `  0  0P@?o20S0S 0000(K R 00 UP 0A /R0C 0a000/ P-L MP0T03 -L@PD! 0P 0#6\ R 0C \0C0060@*00T 0P3#\0Q l* -LPp`@T  0H@0P 0 D B"&0$P 00S 3/000D00D   @0@ -@ppL`0S !S PqJ0S Wᩔ000 0-PL@xP00S -00000$ 0- PL@B00XK0h|010/ -L + 0-@tPt0 ML 00@@@ @@@X/K<0@@0@ @@@0  "KK03__-00\H0^\ ^0^ 0S00Q : Q*000000\ ^\00 -L$M@0 P0`S8 @@`80  (K80<0 < L0S:)=0#Z00S  8KX$P VL008 R0V00 & 00P 00CQ8 5:< 0CS80 8 00` 0 08Kp P 70 K8yP UV00000 00 080 U00 08 @Q0#03R0#S 080@ 00` 0 8Khp P V000 0S00 PU 0S:p80 V  P%W \ Qp!*Q Qp! Q:W Q * Qp!*Q Qp!P S*Q\ \Y:P QT*V SR*V  BS8  S:P` 0 8Kp1 P0P 0S8:0P0 V 0 0<00CS0!80  ` 0 8Kp Pm V00 S 000 V0 0 00C80 P` 08Kp P0S00 SW V0 0 00C80 08Kp P0p 8 0S*VPPV00S  R* 0S*V00P -@PLTHP 0 D B00"&00 $00S 3/`@ -@PLMPL0( KT@1UP!T@!MP(00(0 (Q: K00 $H 00R0S "Q`pA 0 L`p\* E `Vp`) -P@L M`UH`0p 000P @0S `V000HP00pW !D #Q P K4 R @ R 0 0CV <$6SW H110H`W P40S @0S00 80$0S 0 00@00@0P@0S `080 PP Q04 R@  B@ 0WHpV 40S @00CS@0 pl* -@LDM@0 00S D D H H 0  0 -S0H0QV S 0S004ST0 "$0S4 40R{8 80Rw< <0RsL L0Ro@ @0RkWJ 80"YXa00SBW% 0 00U000U0000C00  0  00S D0D0H0H0000009S00S 3/00S H R;  R 2/e00S  8DP 00SV  8:PN (K -@L ppP`00DH0PPPLp`PP˾R  $Kk?]_ -pP`@L B0 SA00T l0@0k@ -LMP`p $H@p0 K5 0-@ PL 000K0hG -` H0L@SP`B   DD800 $Kh"$0S0SKh/ -L`Pp@T C 00000   @0@Kh -L`Pp@T # 000P00@0@Kh -L,MP0%4@8 ` E.Pr8) 0 KP 08 0S000  * 0R*00000S-0 p<0圠Dg5   R ᠎ 0P0 80K 0 SᏎ (K<0 0 Q<00 R@p84PlX8 0 QP0P00L00P ! 0 #꼻غ3 -LMp( K@`P P$K( 0S0W ;(0S 0S$0SH0SU % 0QP0  0(0 I00P000U X 0`F( `0` 0` P0Q00Q0000C00  0  -SL M`Pp307/ PL0( KUP1X!XP1(@P@ 0S* 0S 0P 0S (K@08 $00 0%K"H000T<0@P @08 $00 0%K"H000D0S T00T0pX0@p40\080`0<0d0L0<08D0H0m <08%h0PDpHcz -L00`0(P$@@ @0*,00!p1 000`(P$@ @@ @P0,00,!! 1 00`0(P$@ @@ @P0,00 00000`(P0$@0@ @Pj0,000`(P 00$@00@ @0P0 V$Kk괦O_7'_l* O/_O6_>_E_L_U_`_r_k_p -LMKK_K@/z$/K 4`S`B```` `a`a cbcb`c`c$`d(`d,`e<`e@`fD`gH`gL`hT`hX`i\`i` j    2/KoKxg/Kc/KB_/KB[/KBW/KBS/KBO/KBK/KBI/KG/KE/KC/KA/K KKKK K K K K K  K Kh `  KX 8! KK K$K(K0l 4d 8\ KK?#KKf8K` ?TR 2  0S?#2 0` 0 0 00 0000(Kl* -LxM@|0KP`p` T0 <Q< < 00 0 0000000K -LMⰁ@P`` K0 0 K\ 6-ph1h![;[+[̀ P.YKW+K^;K0YK! 0T  0C0 00 0 0 0 0K00  0 0 00  0000[(K4`(\ ̠ $A( \ 2(1p3B(108C8>@=l* 0-@Ld[0/0S // -LMpPK` 0`0@0 0K\0 0P@ 0 0 000 0?oP20SP dQP PPd(K 0-@L d0 00-L8M 000( ,0 0@P'. , $0A 0 K0بO -LM` 0p00 0PP >0>000C< SJ3 SF:LSj*Q 0C0=P 4D@ YXR * Q'(Q 0  ! 00 @P 00S 0003/:#:S  @(KQ'Z 0 @@ ] 0D &6S0S 0 <46R*0  @000 @P 0 [l*0ʠ,ʠ 0C00S>0 0>00 0 0#L\03P Q03S/ -L$M@:#:S0>0>0 T< *4!P#6DpH0 D 0H 0P@0 <0 KtP' 0@0 5D0H D@(K <R*P R:<$`R !L 0  T!QL0T :00000 000Q  <R: JPH0S80  4V 0L0T :V k80S f80SV00!S 0 00D 0}  JP0DDP 0@0 l] -LTM\  04Qa H0 @T@ 0(KßN@  @N V@T ^K 0W 0C H0 D PS:L 0#3R03:QT0`p0P0 0<0 @0 ^TfL0PX0 0 0(0Sr D0K 080K0<0K0@0K0 P04KKp 0-LM41 DP  K" K@P@0S #  0K @RP K0 0-LM 41@  K"PDKP 0 CK0 0-LM04A K0 0PD0"KP 0 DK0 0-LM04A K0 0PD0"KP!UꔶOOOO̶OOO 0 DK0 D 0 D 0 -LM04a K$0 0D$K0"k0P K` D"QPDP K 0 DP Q 041@ D` / -41LDS,0,0,$0>00C0C0/ -L M`0PS@D$0L@09/@` P T 0\ 0 0@0 `00000a 0D2$K -L M0PS`@x0D$0Lp@07/X0T @ `  0 0  0 DK -L4M8 @ 0p 4P `   R@  R H<  X X80L0S (KY 0H0<0SPY ,0K  #0(0 F P*YD$! 0L @0 LJP+ -LMP(KK R fjAv{(K'K00 0{@(KV 00lK@  p0      0 p K 'K1/@PU{ p QL{l0Kp R.0{p Kp0`V6K Q Q 0 1   0P0 {nY{ 0  0S0 ! !  !  @'K (KP+}_"PR0// PR0//0$ R/  !0l*G- `TP HApP& (0!00C0000 0S   0 0S  0 00C03 $00C$0^000000@P (0!00C0000P ( 1  B P ( 1  B Ul*+ -0` L@RPp0S:0SP|V0  R 0 0P`30300040R,`  P 0]**(]* -0 LPR@`0S 0SPd`y00C0 0R0 00 3030 00R]**(]* -\L0S:0 0B000 $k8R0\l*_ -`@pL PP PPT@0S TH8  P  MP +_ -L M a@0QS W0!>00000000 N@81N@$681HV 0CS* 8뤀p0WWW0@@N@N@W\0VV K(KP< 0 (RJ7l*_7_[@_ -,2,",BL M0 00 y yW p7W PzPOQ0 S00`0F 0!ࣥ vpbhN  I `! D 偑 00 000000 00 (00 ,  (K^`NF8P S4 C400C 40  40 c&$7+++b_l*B}+7 -LMK  p P K8/ -L,MB0SR0S bpdx0S<0 L!yv(K2@0 08p D0 0H 020H0 1L0 804K40 0@01000 0K<0SVڀ1P0 M R   R 8 4"& Z  !   8*&!08 4"&  0 Z  !  8*&!08 )&0!  0P 00S\  40H X000180L 080 80,@`xT Dql*++70 N0 : ?+ -LM`8 <0 @ p4xt2tP8  00"600 l1S $t  l?RPQp R _R@ ,Rg (R! R`@TW WJ/60pKp 0 Pp 0 PA H!0T p  p pQ  ҵ ŵI 80 `#(0<0,00S0!  #wT #W # 8YJ (K00K0 0PW 8wV   #+l*+_* -`@ PL Pp"" v Kh - `L@VP U PV $Kk -LM2P0S 2 Q00(KwP 080 00 040 `00唂qfP |(Kosw`40SZ0P40  0P P@3@Rw8T0P<0 ( w11 P @P@          $nwPv<040  \ @P@$$@TzVt Q00 p000 0 80S[00`l*++ -LM K a2 K3S/- 3-0C8L#8S3 00C0l* 0-@LK0h 30-SL@ 0003030l*3S/3038H30388J - L  -8L  Kh -#L@R/ PU 3033 $3:#033S 0S$Kk0S 3 B# 030 00 PUR z"P }30qS0300C0 08P`%Vu0300 1! Q @ X  $  $  ,( \PP@0L0Q@00ӵ0µ$Kku0S P*l*++ -p` PᔀLUY $KkA0Ds3 0 03x3 ှ3 03 03:Pt+ - 0LS u0S -LM@P0 S 0Sdp&0 0K # ` H Q &0(K8l*غ 0-LM@0@@@0 KK@ \P  u@@ @P0@010S 3/@TK0غ8+ ] -L4M11P80 t1tAl18 p00D0 6@0 L1 QH!  v< `<0,K`! 00 p0@ ^P 80 S0H0 t H0R 00 Z  u0v0p 0@U00UQ0(K l0H0 t H0 0P 00D ~MPEJ+8l*D8__ -`LMvM0P$Q0 @ 06S  t00儽 tKPP 0K  ot0S Po,t P [8l*80 0 0 EtO+ -LMP0@  R00  Q C@ 0p`:tX8t8 Y8Tq $mtkt(KU~ P ( ,"&p@` p 1T<@ 00 R0`` t t00320<0 U" @00S3 032 U  30380080 303e T 00 P0  (,,Ơ03@ @030NT 00<  0S R t00;0K&|ttlsh@ U\X00X0sU U $10C$1Up@`i++l* -LM0 KM K[ - Pp@EVv1 00M `LV0 0 #W0 osns,K` -P儐p儀`LXs0Sh6sLs@@@DsEss +8+l*8 -|@L  P  P \00,0LS D0Q< c_GR`P 0@?AD0l*;8VUUU 0-3L@ P P `0 030300(0, #6 P J 0-LMPr|0!x00Rl00S``0\0@AT T000ֻ$0 000XK0@++l*_8+|* -T L00<S8 Kh贻@ SPPl*+ 0/ 0-P(@Lr0K0hr+l* -`L@V(UQCU 4  10 10 000l* 0-@LPgrL0 0C0,0R0c K0hr] 0 +l*+8 - `L@V0PPrPP V3#03 B# -EML %r5 5@ 5`w_PP Q05E!5ep r pxPrP lUJ r0S 0SYڈ0SV`<%8剺000q 0S0 0 R 00 q(rVq 000 @00 0S3pr1xp pp 0110 yp p  00p 0@ !QRP 0 0 jpP800S0 q0 wqp q P ,0R0S基00qq0 0#R00Sq p38 5qpr# q101Y!!  !!#q"   1/_q ?L#, WLP# ### (,0  0 1010S 0  0~qYm@8qX040X0uqe0!   @R xY  ,KP P2 | x p t #  #  Kq xp P   (,! p p ,0K p @4qxK`p$10$1# #p0 00 WqxKJp @0R * <0Rlp&T P0Rq0 SP @0@_88]0O_l*+++_+^|*+ -CLP@ @L`P 3 p@ -L MP H0K8@4@@@K0@ P PKl* -\PL`P@  PV@ 0,0@V @_T888 -L 0HQt0 10 1P @0 101ZoXo PU 0 R"2P s0S  @P@Y 0R q0S p$@PD@0S Pr0S "@PB8l*](]|/3 /P000Q000/8 -@P0`LP d! 0P@2  . ( * 4& @P" L2 XKh8O/00P/80@-40  hA $@ Q  08l* 0-x@L p d( X4 L@ @L 4X (dK0h8__ ___"_*_ 0-@LP M 3RC40   R h A $A$( 1  B 0303 00 0000@ @@0l* -L MXnT1TqP@T 0 0R410ӵ0ŵ(KoGn 0R00 0 3<00 03` 0(P 0,0! 1 Y @!  ! ! R! !A!0     0 R$  $    +l*+ -L,M@   \#2\T S`!j3pAFp^P %Vp Q": S00S $6'00 m, (00 R 080 00D0 O@t0P@0 80S 080 vm$(0, 0R$640 0&f'v#60c<0 0F80 /`T0PD0 80S Pm(K080P40S0PU NW*s@P@!@1w40@D @S0!00 0@@0 0 Y@0P0TW!@@Ot00 @P0100 D0@@0 0 R < I$@@D @@L0  D0H0 CL00X 0@H0S#IN0L P0 3L  HP00 (0  )80P`' P`! `1pF 4 004 S`PUG *H Y*00H 4P Sp10<0 W'<0P0 `GF40`EY`1 `!< <0Pp1F@0 <0  DH 40H 0S40 `P HlX 0S 0q>H 0E@*l*+]_ -D0, 08LR (z*,\0h<9f_/0@/h/-,0,0 QԞ" 0P1h<9 -@,p|QL`T#$ R R&R$*&    0R 1`V,*딈 `F`PV,PXE,E@,p#R@o#^ A  BA  0RP0`V w%`F`PV,PXE,E@<9h_ -LP`_,@E# P!*   0R `0`VT)!`F`@V,@XD,DP<9h_ -LM01p0PS)@` V(0 @((U00 ,0 V,0 $"0 pp0 `U t0@`(Kp04# 0SX06#,C T,IX,J@l*_h_ _@_<9p@-,`\0\P0S  / R$ P :P*Q @p0C?0h<9p D00P 800S , (01 ///h+<9 0-L@P0 0-L@PD0 0-LPP,  05$ 0<9 0-LPP,  05$0<9 0-LPP,  05$0<9 0-LPP,  05$0<9,0 ,P 02 /<9,0 !$/<9,0 !(/<9 -L`PP, 06$(P<9 -,0p`РL0 I W6P@@P  80 #6< @ D H L  S : S *0 0 00 0Wjjp<9l*+ p-P0 ML` L0LP0S00? 00=0   ,0V$ Kp+<9Z_i_ -,`LM0h@(0 P@' 0S2@# 0 0,0㓕$(0K0@0P00 ($K<9 p-L M`00PS@ xx1(t00Sl T`\X%* K AhP@(, 402!P`$@Kp+]v_l*____<9 -LM< ,K!8 PPL'(K8<0pW?'P10` @0 R00S WH*dp',Pd18@< 4$0! |P W,1pW ',`pGp80c#``80,`W80XF,F080 #*@08@ R< 00C 0,0R$ pp P0<`P&` , L08@<4$H  0`C ` ,&P.] _2_+W_<9h_l*_ -L,MpP0AK7i#K R0 0`oiV*  0@P㤀#KT0(Kh``F,K&f`*i00 00 00 1/0f 0@P#K@P 0-8 ML  000 000   K_B -L!P00B "B QP-LMP @`pM Q 0 =S 0!  V0 0!ı60!R0 0!ı! RAZ:#Kh#KR 0N 0#Kh#K!0 ` pZ#` S 8` pa`0(K VP SR -fpLM@V@@Kl0 R0 0S  4\Q P<< 8H  BH /80Dl*T0 R0/0S  (Q, Q80D 0-`@LPU ` S  R   00 `800p <00@8@@H00H0 R 0 P0S  0  Dl* 0-D0LP00 @ST000 k D -@0|Q00P0L0C`P0hYP''P""R,40 qt0S)4 140P "gL00CL0$ T00CT04>P% `g000P00P0g`x0``FV`V8`8g, (50HP `l*+DGD]_l 0 8D -L(0M 0 0  h KdQlP -00ML06 0 0h KdQlP -LM600 p1!Pa4 P80 Y@P  0  P(K? 6%:V T[4<0 6 S  !<0 !<06$0 000H S| 08P0f0T  T .gX$ 0 040!800R000/XPмP ;00S0f0 g +G0!CeLO -@LL D0RH`P000L00L00PfT00T0f -CMLMT4 1HPPP$  QP1P!0mK `Fp0X4 W0(K@ 0T0C pPH R 0B.1\4 n \4D$  <4 X@$ 084 P4S 3/T$ PT48@l*D\ `P/0 !`8 00 (  , !/,LP 0!< 0`4 0 (   !/,LP -`@L$0  C00C0 00C 00S0G0S   R0 L00CL0000($Kk0S0=DE -L4M<08P@4;TP%VZep4fW00$00(K4(`tPEaY! Y # ?# "0 eeeT00T0e먀00 h0P0 000$H0 ;@0 4D0 X00K@ ,`K 0&? 40K0<0K0` 040PL0 #KSR#L00000 0S`x@`ᮽ @K ?80㓪& `FV4`z᯻0 00ɔ00$` `0L00H0000)#K 0 0<00 t Rp0!"P0S Z | 0 0 0HO000A $K ?$KH0H0H0 v+M]_EX]_D0P p-8Q@01LMAH@[ da1 dP #ZP @P000@ @@@@!>4Pt `0 0 0 `@@i\0 `@0@0 _KpDl*+G]h] _._I_d_l___E`ES Q N / -LCMP0 @S`Q P7H00(K8 ,ߓ00CS lPPPPPPP603/P& 60`B>  000 $PP0 S 0X T FP#<6pP P0SE?K% P00CSk!P%PX%PX%P PX%PT PKY`P0S|% u ( 0T 0 1 0 1 " CK`P Pp t0SPp0^P4 p  4hF>u`W @c`PP  cU E P? @: 04p0t0PS 0p0! $ Hnc5`P cHP  P Zc 0! ?P !IK \34 1 XtY Y$ P0P 10X 1" 1" PP Fc]cHPI?KOp ?4; fjt0SFPPYP8 010X!820` @0H 4A#"#04>0C6Y 01 1SI   >K!0PPt0S( T!0S"   h 0h!h3P XX !1K"^ PPp`0`00 @x0S0D01,`(0b0000x0L L P PbxbOP\bP0@bPPl*Elx' [G__+__Ł__ _+_D E_pPR_v]Z_ -LpsbPUb,KoA@T P 0&$ 4`P ` ObZ `8 <0R0<0# @ H00CH0XV 8@v_E+DZR__l* -L MHpH0PSK0 SQ? 00b `V0S00S4 @T ` 0)  0 0S#0Ep 8<00 Q<00<08t0800<00@800 00 0T00T0$b(0 (K8@ bl*+D -PPLL@adX<0a 0TP@T@@b+l*l -`@@LPau( X00CX0$0$Kha+l* p-L`PLa]@( F0 0 0C 00TATKha+l*00 D 0-LM`@q \0P0\0 @0 6K2PP(gaX00CX0aK0l*+ -LM@4q`DPRa@ !N@@( @0 DЂ QPpp\p#p2W }a p$K0Όƌ R( oa*p0 0p0 D(KpP(00D@#F@Yap B,(00C@#FD@-D0S h06CSa@0!Ơ0P8 @`p&&'6*U\/R/>0 0  -LM#Kt0`@SP  @ *060p#K  #Kp` P(Ko@ -`pLMP  0@P0 (K# 00 0 0Q@P ` `# 0 #   3030@i;P0#10#0 S#__ -LM#KX Pp, J APXpJ04S Q 0p(KP#K 8 P8 P#K*R0H#K0 @R X#K*0#Kp WH#K kP P -p`LM@0 p``$V    W  R 0 00  0_ Kk)` -@L`p_dKh`H/H  /H   @o/ 0-P00L@T0別P @|0/| -L' 0 E| -L M`Pp30P@00 pP0" PPP% K|00S0@@PtP000P8QU4k@ KP@E|_ 0-LMPP@! ڎP 0xS    KCP P 0S0C0@0T,TK0@E_|-/ -@Ld`pPᦎ\P@ @T@ U@  4/@`E@0S`04/0PQ/Q   / P/P0S / 0-@L,00$00 000 00003P4P3P`4Pm?oQP0@-2 R 0R 000D$T000 -LP@T@000`` PpW#  P P@p @pW  P  P0@S0S0PPP@P P /( 0    /0PQ/Q   / P/P0S / D00-0<0@040L0(0 000006P 6P`6P7PP P /Ի -Pp`娀L 0 HZ @1@!0 ~Z0 :@j D 00 0 0pG000 0`T* -ML MP`0S E 0C0@ BKI J@HT  Tp1{#H0 P00C@D0 S : 0CR& P@D*CKA 0   C>K0C`0 ` p` *4 @ (K -LM@p`P0 0K ,P ( d0 ` \ K p-LkM@P1 `0@0nK^KPPD0n/K0!^?KF? K1"MKPP1n/K%0M?KKp__ -LAMP  04a  x!  |! !1 1 0  @DqHL@T\  y K 0 p 弐 Dt} Kx0|0 ]0x0x0 2 t 0$0p0 M]l h d ` \ X 0 PKT0 Ң0#00KGK1@KQ KK4p@P20T#0GK0DtGK[@P# \pW@ȡ ̡ pС ԡ ᰡ ᴡ ḡ ἡ8A 0U8qGK9@P \ 1T w4q` KT2T"K0 L2 H"0 D2V@"ż0 09K0 4040Ӭ0 \0ð0 0 ŰjKѾIKѼIKѬ@ @K@ @ 9K40 KX"@PF1V7ugb1 1 尐 0    p40AK C/Kx  ]@P0S @ 1  1@ @@  0 %"@PQ% W  ( KC(0 K` "@P P01 (K0 S1 0!PPU U0SP  !P @>_ELF4 ((8P0000/E000/-AM 8R#8 'R R, R 08P#80$Q  44 0C8#8SAߍ E0A- '@pP` $ '\  \ \#Q Q@0 Q Q@0 pRS*  QQ0Q0E! -LM`0s00pQ 0Aa 0@\:#: (K0@ΠQP@_P@@A0 040 0 S2:00N@@- R 00 pP0 B 40.  0 0R @p B pP@@X 400T 000 pP00 pXWP$YPTPP Q /17t7 -LxM`KPx d@TpC 00 0$p0 00 00 00 00 00 :0 0|0 0x0 0t0 0l0 0h0 }>d0 0  0`0 ` 1\0 0X T0 0 0P0 P 0$@KL0  0D0 41H H24pK@0 00$:0p00TpG 41p000 @EP @@ =P0@@@$K p-L M@P`5P KphrKp  0-LL@-P 0S 1(S3 S2S#00_ -LIM0 @3S `PP1S S P2S DPP22$1 $1 0 0P0,0(04000 0"R01 rQ50'0CSPQx7 0 0 0PP?Y00CPh0PU ,0K⠠#0 15/PP)̠X0Pp q 0q B0!"R!" UP10Q U!3L0Q*CPEP10 P1Sm9$Y@ P " 0UH001 00 0Sv S001  2 S0S,1 ` 00s0~p~p0p401TSG pp1 W4!lPP+pp0$p0tQ1"PP1K"PP`0(0 $ 0;0gPPw40 0 00. 0. D0 (0141D0 >0#60KШ -L@X 00 X00 `p``0Xp  pP -b 0`pb 0L@RP:U@ P 00 0000P -tL@$`pd0SP`0 S0000% P PP -LM@`T0  0/ @+ P4"p@PL0L00L0 0 q 0 0De@P 003/ K@ -L M04a2@00 0000 pPP  10S  , .  DpK 0-LMP@P 04*"*0C000C0 X0  00. 0. DPK0hK0 -L(M0K0200 0 0 P0S K -LMT0p $#00<0<041@0CUT@@@41<@H<`@p0FPB 80`F` R 0C 0Es 0 0000 00P0F0P 000PP0 KPTP -LM0@`0 0 `/P 0 K`P p0m/KdpP OgU00p0K !0a0[H[8[@[edA -LM4QDC@c 8⮚Tp0S U 3 KiP(2,K 0!2 00 0*D.`P Q0  '$D0 倂 0xB  pAT \XKPP<KQPP\KHP 0[/S],0KP00E@K-0`0K`Q s00K0 K0K PU`P0 T | 0  00P P;0 0C /P 0 0  P0@P  KP ` P# KK M600   P_oTRPU `uAT00h;(K>FP _T]8_ _IE___L]__D____ _ ___* _ -X`P𝤀0 !`!800 (  , !,LP 0!< 0`4 0 (   !/,LP 0-,0L @R 0K0hAH[@[ -L\0P0 `!d 0#UF ?,d 0T@!8 0-L`M00@ 0 Q00hKP00hKhK@`T#ʸ@Q hKh 4/0 0hK&#:qhK4/0hK0&#: ehK\4/K0@DFإT+^ _,^^,^^^T+^*^4^8 _l* _ 0-'@`PTML,0?0? 000P(`$@ @@@ @p˧0',0t?0h? 000P(`$@ @@@ @ᶧ0',0(? 0? 000P(`$@@@@ @ᡧ'0!>0 <,0 00P(`$@ @@ @ጧ 0,0> 0>0|>0P(`0$@0 @@@ @w 0 ,,0<> 00> 00P0(`$@ @@@ @a,,=͟ 00 0P(`$@ @@@ @`L0,00.!= 0 <0P0(`0$@ @@ @70,0\=0 <0 00P(`$@ @@ @"0,0 = 0 <00P0(`$@ @`@@ @0,0< 0 <00P0(`$@ @@@@ @x<, 0l<$0< 000P(`@@@ @S0,00$0< 0< 000P(`@@@ @ͦ0,0;0 <0 00P(`$@ @@ @Ḧ0T˟,0t;00 0P(`$@ @@@ @ᢦ0',0(; 0; 0;00P0(`$@@@ @ጦ0,0:0: 000P(`$@ @@@ @v 0,0: 0 <00P0(`$@ @`@@ @bR D:, 0 00P(`$@ @@@@ @`NR ʟ90, $ 00 4P(`@@@ @7R hʟ0, 0 09$00 4P(`@@@ @R ʟ0$0 0(9, 00 4P(`@@@ @%0,08 0 <00P0(`$@ @`@@ @&0+,00!8 0 <00P0(`$@ @@ @ݥ(0,0H8 0 <00P0(`$@ @`@@ @ɥ)0,07 0 <00P0(`$@ @`@@ @ᵥ*0,07 0 <00P0(`$@ @`@@ @ᡥ+0,0d7 0 <00P0(`$@ @`@@ @፥,0 ,00! 7 0 <00P0(`$@ @@ @x-0,0;'$06 06 0600P0(`@@ @`.0',0p6 0d6 000P(`$@@@@ @K10+,00!6 0 <00P0(`$@ @@ @620,05 05 000P(`$@@@@ @!30,050x5 000P(`$@ @@@ @ 60,005$0$5 000P(` @@@ @70,0404 000P(`$@ @@@ @ߤ90(,00!4 0 <00P0(`$@ @@ @ʤ<0,008  p$!,4 00P0(`$@ @@ @ᴤ>0,03 08000P0(`$@ @`@@ @ᠤ?0,03 08000P0(`$@ @@@@ @<@ @@ 劤0,0X3 08000P0(`$@ @`@@ @v@0,0 3 030<0P0(`0$@ @@@ @`aA0,02 020800P(`0'>$@0 @0@@ @KB0,00"!\2 0800P(`0$@0 @@ @6C0,00,"! 2 0800P(`0$@0 @@ @!D0,00!!1 0800P(`0$@0 @@ @ E0,00!!l1 0800P(`0$@0 @@ @F0,000!!1 080`

$@0@0@@ @UJ0,0D1 0L10800P(`0<$@0 @0@@ @?K0,0101 0<00P0(`$@ @@@ @)O0,01 010<0P0(`0$@ @@@ @0,0<0 0@00H20P(`0<$@0 @00K@ @`0(0<00@0,P$@02 @@0<000K @`0(00$02ܢ0 K 0<00@0,P03 @0800'>00΢0(0;$0 0 0<00 K0@0,P @0`30l30'>00ᶢ0(0; 0 0<00 K0@0,P$@03 @0800'>00អ0(0<0A 0@00 K04,P$@080 @0'>00ᇢ0(0<00 K0@00X4,P$@080 0'> @00p0,04 0800>0P0(`0$@ @`@@ @[0,04 0<00@00P(`05$@@0< @00D0,085 0<00@00P(`0\5$@@0< @00-0,0<00P(`0@0$@ @05 @ 050800'>00(K 0-L8M! 1@P`000 00`,P(P$@ @ @p 0,00 $00!0 0000000`(P0 @0 @ޡ0 ,00!T00`(P00$@0 @ @0 ɡ$KS _~PPP[ _pc _ -LM$Q (R`p@0 R0 0R0 R00 0K` X0 KT 0 0@00 0 0@?oP20S R 08R|P|P|P|P|P70$K887F -LMp0`0 @#&0 9 !|0KP ` 0 KL 0 0 000000K' -LMpP`K0` @0 0K\0 0 0 0`@000 0ՙ?oP20S  (K\[ -LMpP`K` 0@0 0K\0 0`@ 0 0 000 0᪙?oP20S R (K謻/u -LM@KP`p ` 0S S 0 0 0CS0#610 0KT0 0@ 0 0000000l$K$0 00 B":&0 0K8l* -LM@0p0PS` 0"(K|0K` R 0R RK Kl!00L < 0 0 000000-KTg -@LMPpK` `$ K\ 0 0   0p  0 ` 0P?o20S 00 = P00  (K -LMA 0 `PpK` +0\P 0 p 0 0  0 0Θ0Pp?o20S00  pPp0Sp +\0 y(Kā -LM@ 0 `7PpK` +0\P  0p 0  0  ᅘ0Pp?o2pW0S +\0} 8(Kā -L|MPK@`` pg0X0 X& @!1D0 DD T X 0  0 000P 00008D@Tf KX00?@0@D0 ; -L|M`K@P` p 1X X4 @/ U(R( L L0 L3L \ X ʬ@ ؀  0 ^ 0 0 000` 0000L@\(KX00?@(0@L0 ;  -LM@?P` pK `  K\  0p 0   0  ᪗0P?o20S PR @ `'RP  (K NMb 0-PL@J0S0XJ -1LP1@4%^p `4q  0V 0P0 !(0P:0P1 00$0H$0$$$$0$P0(00,0(0S0 04000$ t0 l?S  Q Rp 0 S080t0900S  @⦏V0|H00L0 00P00T0<0 吁X \0`00d0x0h0TQl l$Kkb`]]@B -pLM`@#WPK ` 0KT0 0P@ 0 0 000 0?oP20SW0P$K -LM@apK  ` P K\ 0p  0 P 0 ẖ0P?o20S&00 0 P 0R K<0T @)KK Q 0)K$000 K4巬(K谻ɚ;6e -LMpP`K` 0@0 0K\0 0`@ 0 0 000 0g?oP20S`@0S`X0K I0PS Ő00 `PP<6(K註ܺ -LMR`p@PK A?K` 80@ 0 0 000 0P !?oP20S$K -LxMP@K`p` T }ӻ0D 0 0@ 00000 0$KĀ p-L MP`,00@0S 0 ۊKp[ -L,MpR`020 (K/_H@P0S@DH@ 00P0 Z X LKKP0  0DKH  L0 @{H LK$2HZ H @P Ȁ -LMQ@`0 P~  C (KR 0@T@U@Tp0࢟P0 ɚwNG2Up010#0 X `0S00 xP t2#H G딠Z HL2Gw0YSv K  H H K9 P  w    G R Gw# ZM 8!GRPG 00 wpGW GU010#pᔠ0 Z  GcwV# 0`GV`!*E n0YS- UK _G G K P iG R Z 8!0 M@ 0pI0C0 @8v80G0pI0C0 @8R= 5>> -20,0$@ @a@ @PI 0(00 00,$@ @a@ @P8 0(0l0,$@0 @a@ @P0 '$K _^ _a_{^R^_j_ _9_ _]^ _T, #60@P R  P 0 / 0C -LQ0@`P a"WV:`Vp0S S0 0#d 0㫹QP*0x0 0`pL0 0#d 0㑹QP:00$G" _6 _ 0-P@LP t0S  00P 00000$G -LSs@ `PUtPs10t0SXxs<0800(1sL _0G$G` _w _0000 s$G -0ML00`p =PP9 K@PP00 1@ @ 0 p K@P 嬯Kt0S  @"t"K@P )K? @RKP"KIK@PoP rZ0S@|%s0000q@P F0S00P00 00@P $G0G~ _HP -LMRp0SP4A@ lK  r0SPlf@0  K K@0lK B0 K0Kd 9CK<0K|K> C%K<`>C'K R00t'KAQt  R0'K=9 =t0 t|s(KK K 0'Ktt Q 0'K=9A =Ct0 P1| @1tNK ($00,EK@0<FKyL |`H Bl0+ 200S& .#KB?0 40K0000000 00 @0l KPP  LV K@0 K0Kr(K 0$G?B> _0G 0-P00L@T0&P @ -@LMp` PUTV@(K 0 00 000 00000dG 0-404@LQ0S00 ]>0P00dG00CS0/0>dG -L>dG0/pG -LM0p0 `0 0P0@K0 |00  0 R  ` 㕵0KT0 0@ 0 0000000| K踻pG -L; <;0 @4q  &*?SRp#8 P#!,*0`00  30Ss S@p001 ;UPp0S1P00S;Up/ᑂpP 8 (! ` R(PWPP ?;81<;UWc #GQEPY V 41 (K%S. n BR)hPPPPPPPP"?0J pPZPx0d"2\"J0000<0J> C $"0?Pp. 0P J/K01 JPP(` RP(PWPU010ܦpP P 0q 0 0 1 s- lCKPP ᯦0(1 媦(t0S P( (tUPy KP0S P8UKȸ0 *K`0  00S 000 000 000 K(/0EK$ 00(1 1 0 ,1 IK 03/Pā> G^4^_61_T] -L,M@P!"K0pQ 00  0"Kp 0 -!`P 0W4!D0x</`0  ${ KIp^j__/\ `P/0 !`8 00 (  , !/,LP 0!< 0`4 0 (   !/,LP 0-@L40040K0h -pL40Q040U 40`蠟90@T9,KoS 9 9 Y Y," 9(AP U 4  994  4 ,KonP *>@@= 0-<@L 0G9K0hC;; -@QL8 @2 0!1 !0 Nh 0S0 0Ag%`P0T100Kzὤ (B0 !1000000;_/0 0S/; 0-LMPQ@ 4K040 4 $ $0Rl0Sd0 @}  U D 00080 "40  00CPP;@J p-PL M@`8|1U3 37US `1 03/AH1U@ 3C7CU( P㑯10S&P" 4000040000(00,000 0L1$0P000 0PP00P:P\8KpeP iP@0S PU00 000;c,`c; --LM0  0 KG/G-//01, /0 600/ -PL@n@@T Kh8 0- L o_ -@L/  7011>101?1?11` P@ V@@ 0-@PPL7@0<0C@00S  0 8K0h7<@-!2 !@!$!!!r!E0!311S -A`LP. 0-L%T0p@-!2 A!R!!r`!U "!P "!00\p!AA 2S^ 20\00C0CSQ Q 1p0 0-@P@ LJA7 @0 S:|7pp600@00@TPS0 P7001Eb70<__<Q- 2  a>Q 0 "Rq0 o`0 -pp0L@T`0S4Pm60 P P$p0P7@> -QLM 0 |  (KQ0pS000W0 00 0?S0IS0 0 0I?oR20S0I?or20S^Y6xW01x0#0 363P00 U `0S6t0S3 0Sx0 R, m60 ` 6V00 zfP 264@=0 Q610 00V :62E6fP010S @T Yt"$ Qx W  Q Rd 0 00 $6x00 $2!47Jx K X   @ X ( 0 0 0 4     | Xx 0t  p KX d  ` ( R Xp\ X KtXL x| H D  @  8` < 4 00 660 K5X000 00C0 Y0 0$000Cs `gdPY \@00S00005 5g0S 0*0X[>>d -LlMP314IXP03@03?0 (K@THU2 0pKp0 0pP P 20Dx0 h52pd52PU `0SPt0SM X5000 0 ` 5V=00 deP6 $254@=0 ;51|0 |00S|010S @T  )500S 1$ 0R a5`x0?S0G 0X5 U5d15dZ>P4114I @ lK0KS  d `  \  X  T  P S<0L $ H ( D , @ 0 < 4 8 8 00 4 5@0 lK!Px0@p@0Cx0 h00$0T@00S0000$0pG54pL>d -@Q8ML 4x1@ta0p1pq` 0@@@0 @HHQH1 0<1@@ 001@0:81@0 1@@ 01 00)0 ,00`pl!P0 000($@ @ @p`M0 ,00!t00(0h0$@ @0 @0 $K<`P_P 2MR  !Ѝ/ -l0p@`!L4Q P    ZK -LMP@`p P @! 0t1 21 0 01 t  PPR @0 @@0 @PK -e`LMV@8 `DhQ1 r100 000S>H1 D0  /"1 <0 2@0 < 10@ +11 R /80#+ b80 48<00 01 4EX D0 (K14 /0P g J/  x<_0Q`/wt@ -LxMPPp`@ x K4t@ d@p ` '/U (:P  Kh^/Ke(:P 0 Kh> -@XX`L "+ Pp0(00 p 0140RQ-//-//-/-/-/-/-/D / 0"/// 00- @Lѥ 0@ * 0 -@p8PLQၤP@h -PH0Lp@W``Q gP P@H -`@(PL.$@$@.$H 0-@LDz.@ 0S00  R  K0h.0$Hh 0-@4PL`. 0 0 00 @ .0$Hh 0-P(@LL."0PP.0$H -@LPT D0`00pH05.00Pr.(] -D0QL`P@  .@ ?R"0``U W. -@D0LP` .0S00  R  Kh>.0 0-@PLP- 00 0/.P@.(~K0h  - @0 Sa 0'C!a0 '1XLPS 崞 P:xۋ (XpP 㸙``- 0 0 0Pp-0 ᾙ輻Mb P -@PL`-80p080080p04 00@@0@@0@0$Kh- -@Lt|-" 0L @D Q0b 0'! !31SP儙Kh-$HMb -RL@P`H0 03/H 0 R!!0#4#01! 01 R&p<-80$ @00C@0 0R 00 80080l- j-H00S L5XKh 0S  R- -LM@`0q- 0  7PP>-`Kt0S ,3-000 `P (- `7PP 0DP    @ : 0(  ,`$ 0010 0A-> -L MpP,K(K`P( ,0   ( D K@ ,l4`,0(@@D%+ 1 2 01( ,4x K8]_ -APL @`,@pW0P,  " "P 08!/,0Q 00P03 0#@2hH -L Mp4 `XP[P 0S\X(K0Sr Y \X 0P00  %,1 1 R!Y @ @ 04 S 0R @T0 T00 D000400 0LH0 0<00@00! @H00SJ1S> @=0!#4# 11  P 003/P; u000 0[T Xc00S K +렑Y 0#$# ! AT0@   S 4R Q @ @0  11 0R!ź@P⏜0 H0 03/P 0 40+80080+! px+8008080 R08004 00@@0@@0@0$ + + 0<00@0000T   @u (H  -@L`0PT 0T @ZP ,rZ0@lZ@0,@P<ZHPZP@ 00Zk (H Q-L`@ 0PU`  0-80L@0DP *01T001  T  K0h+0 -L M<0 PPY@p` D R d0("C;004(00,0*80$080 0P$P90 0*$K*Y< 0@0 08 :0<0 0( 0 40 00D ,0 *DK(p}*W$00$0$P$P* -` @PL}P0U ^* -@0(@P@1L b}O*1S1S@*@*4"D1 Q @@10S 0-0@L Y * K0hHQ _ -L MPp` 0QS xQ Y@P@QP HY(K0 s  YQ' SPS0PPPs E ܠ0S  00 >00 cPP0  5) 0T 0IC00J  V00YH(H 0-@PL 0S YP |nY0@P\fY0PU @_Y0 PP  PQY0(H0S 0H0/h] -LmM  ! P pP (0S  3 0S 0 0mK 3/P&m?K 0 01 U#Y10S1 5P1 21 0S{ iOKeKpD1  (KU`1`#0`@K/K04/PKOK21 0:0P0@ 0S 9 0000  0:/P00C01 @SPE0P0X aK1 0pL1 (01 @0S21s@ )01 Z 0 @ 1KK4/!00C!0 0!4@P  0S eKiKS0P1 t@ #T0|1 0a/KKoKx1 0 _?K001 (1((0@a/K T 8!" S4@ ( Q   a/KT40!Sv(8  8 " 8 @  B@  (H0 03/ F(80! 0R!080@00C@00 01  80F 080@00C@0g( ((Z@a04gV(T(0 @ 1KK4/@((1KoK01 0! R!   T Rn |!x1R 00x1|! 4;*(((  $!080@00C@0 !00 0080 0 00@@@ -LM,0 00000 00R Kx] -`@LTH0 0P3/P @ -`T0L`1 RM'1a PKh' 0'0  0-@LCT0 0T0` 01 " @d\ lP pP D劓 0HK0h8Hā 0-PL@G'0S0' 0'呌8H0 奌8H -LMp`@圠8 4 K8P9/PDPWe 4\ 00K  P ?P(K0S 0A03/00`@0@`[ -LlMP+@x0T D0 @ l0 hP < lK▘PPjX` `tQ"XPP}"$iPPw`0(0r$ 0;0"PPhp0K02 0000P P 0 P pp B *L D!DP @1 R k(-" P  h ! 2/PPD0P S%*L S":,0S!044 @SR(KlP  l pP  p t T Wp p p PP$8HN/ -L,MxqP `IX@00K+8p PPC0/S Vu(K00 0 S0 ?P#/* b4 40, KC"/C418< @ pU00<00< UXP 4{pG ֛0VPC00pGp80 $ā -L4MH0 0p@4a嘄T @ D0 `0 0L0 \U80K0 0T~PPX@4 D8 D1H00Z0 00PdPxP P0 彜0$0`0 C5<0T0lPpPhPtP⮜$U PPT0@4 XQ \PTPQhX\&T00T0@0S T00K@0@000 2 040KBPPsX10 \Q0X1H0S 2 0H40K 0P /P\10 0\140h @000C\0X1T1 $  BP! 0@ 0LR}:@0(K00@0 p00  0PP A@0'QPF#P4@ @j lZ0S |g40 040 X1P0X1z PPPX\T00T0PT0 0T0` " P h@ lP PpP LTDv `0 HLT E/oT0D"0S RD0 P PP8Hā4I[PRPR00S P 3/ -LM@0 `p,0 0h (K(0  0010 P40 DP K4K<P00K'4P0 40P040 (0@ 0CS(0 ,K$P@`Vp Z,KPp4KP00K'4]P0 40@0P40 -PLM& @Q4@ aS  B$ 0 @@90 K4K师1 010;0 @00`!P`pD(@T W,V/AU1@P 000 S&(K 00S S S ``pp@PPtt' 01p@ 01`@ 00P!0 R 8Hغ(__$]^ -PQLp" JS0@(Q!`ȀVcSP `V `V ^hSP R(0 5( r# 0(0`0S(0(4I$L -@QLp+ SP`U P(`U!SS@t#( r,0S#P0S `P, P#X8S@u"(P 0QS   P4I>$(] -@`PpLU 0S   Kh 0SP 0-L@ #P0[^#`P dP 0bK0h -LMP4Ap 0 Rʜ #`$K   `P00@0p00 0 P @0ȟ'YX< -L0h0pp000K03 `00f000q00pW 0p00r00r0000P !000p 200;"'0D Lr001!20 0S l0l00l000S0  0@00\0h0>S |0|0S|0|  0|@01 R @@0n$1uD03/ !<J|0e0000t0(0 P00! !! [ |A!xvQtQ@08 T h0  !h0>S !(K}D@%00^00p\W`q w!8  [8IQ8GQ @ !B___8Q>>4I -L4M08 p10K4AH`P`|PU @0〠p2 @PP0S U @` X !S @`P10[SR8045V 0TD @00 P0 PPTl1 <0 `@ 0V*:<0 & `V 00 ` |PP0P001 K0K 00800 PPQ  0KPP(K@0 0S 00K+PP0V0 +`X <0 jv@ꤻ<āQ 0-x0L@S0d3/0x0d00 -L0#6000040>0#60@0>0#6000800<004q P Ż  0 1p0X # 3W R , "  帻W3/g gp' H0p̀@0 H4)X1@h 41\1<1,0K#p 7/pP L!<T0A   01 l0 w000l  l 0 4h0  0 -0  0P*pW9pW`0<`0/L0      2/ p L0Dl0P 0- I-pP0  e0  eQpPW pGRrGR00P 6 _20p 00 9 h0 0,03/h00S  3/h0 (0S $  QL Xo.(0Xg Lr0p03/4,K P00!4p 00 0 ᓕpP> h003/DJNP0S8ND噋- 4 H($HI@ lP SpP OT0S  opW^kL  <?L <l<D0 (0$D 0Lp@07/,pK'003/3 0000 0 D&pP 003/<01@01S  +h04q 00S l0SV8 N80l  8 VN0pl0P $1S 8 R h S 2/ g00P1 h0 000S 3/h0 0$1h ,!D03/\10S `&NP0SL!N0Ch T0% " p : X4d03 ,pK000 帐(' 8p T0(0t000C0Z XV{g<0 S oSD壊7H0 H2p(K=[>8Iغ_4Iā8H0B 0-LZM]OK@PP0 @K0 -LM00 KQ -L4IP/`0S/ 0-PL@}0S0 0-@Px Luh0/;00\Q 0S00(2 d00000(0x0 00+$<00,0<00000 -L M@ `p P>Y h@Q>Qp@Qp@Q`@Q@Qp@Q@Q@Qx0S o'P@ t0S 0 S 0`0(K `0 t0S? U 0000d0 ? R00(2   00x000<000<00 0W PX <\0 Py=X <XPP0h m= 20S `20$00P0` -P4aL@T 0S 09P T %$0&$ ( R 86$0f8A B 0S/t B\R R  B 000X00S0\0x0T10S  ( 00S0  00/G -LMv4AP0S d0:d00Sڑ0K0)d0吐 Hf) <9QP ? =0 0000 t t0 0C0( k id !0 1111 Q0 t0V0S sPP1S 00 J4.8|080HRO?(尀$180S 3/N=}p0  A"l0 00l 0 l  0"20S3 Y  40Z00 0 S  dTM YX X B%"Y  &ŰG)01S h0Z(1S,!,!(!,1 0S   2 R @@00ㄠt00000S 0S  ( 00S0   0@0`0 \0S K  K S0<0 ;X D 2,2 Px0P &p H1(p5H1a0 tp0C000000VbIOd0F TBb 1o0P ! iPm 0S Q h 刐  h #+h  Q Q ? p U J 5 1-0SlG_>BX>>_ -4QL@ `d0  < 6 -LM0 0pS @ ` ᗐV ᑐ780S r 6X14Q WW w2 p0 0 00 0S 0`@0 0Kp Pu Z$0  \00C?o2S Ph00 0S Ywh0 W6$P \ kh \00S000t R R  0 Rd  !d  00C0V000B 0t R Rh       B V /  h0 000@oᴐYP㨐 000 ut0S 0U ` @0KP 㨠Z4Y 0S00SPM 30 0 0 (K3,K0x0*"P 3,K0x0*P a t0S000 t0S000 0U`0 =P 0U`0 0P h0` " 0V nh0 P3;h0@ T2@\0PS K KQ02 @< 0P00CP0< T00T0<:<X:<<X:0S X <᠏X <000(20t00S   00C00S  ( x# #$ R 0@@F;<f=1/ P gp e$clG #1 B/o0"S R0 400 x0_0t Rd0 C;00("4 0S 0  >>>G 0-LM@0s ScT0P0K` ,0 TP X KK0 0-L`MP0 @p0 0pKtKSl0Kp0S0 Q  tK. 00P0S X lK$K0 0-LRM@0PS 0K0 0RQ/K 0S/KR?KL1000P0S  RK00P0S K00P0S QKK0 -h0PL;U@`h0P 0P *P n * (h05h0 0PKh[ -4ALPh0  t`h0  KP00S KhbY l00x lQ>[ -L0h0  000K0 08  000@00?0 00""$140S  3/420 0S l0l00l000S0  @匀<0#\0h0   R#0 00S s|0|0S|0|  0|@0@3 R @@0b$1uD03/ 3   R      20S WP12101S b01S xw up0  p<Jnp 0`? 080 a80 SNd0M 0 0t 0000( 0Sx0 000 !h0   R!0 00S 5h \100X O01'$An%  @ 4cv8 8@0l01N000t0(0cC00Ds1Sh 00Z 0 gO<0,<@I_9_._'___GTSQ>>l*[ 0-LM 000 K 0-LM 000 K 0-LM 000 K -LM0  , R      ?R0 0000 K 0-PL@0S0 -pAp1LQ/P@n`1<<S81ʀ !` ``&!4  4 !`!`00, !  !0(0,22,2C_CP ]40˜SCP#OCPh1S;,PL 0-LM@0 0h0 00K0P0\PP @5u0$  $ 90 @0K07_]Q?_ 0-P@LT00 3/@ -L@`P P` P00S0@0S   (   0-4@L0S0 R 2/  0-,@LP00S   $00S/ R0/0  -P`0@LB PLC4I 0-P$@LBK0h:C4Il t -P`$0L@T03/@ ^q 0- 0L@T00 3/@ -LPp `k @P  p `Z40 , R @@0@0Y_ R 00 i  P0-qpPPLP`00@T 0 0S$KkqS 0 j0 3/00@@HT 0 S 0 V0 3/@]~^__ 0-PL@0S0 0-(@L 000PI_ -p0SL,M`@P OuP p 00040K00|p 00  00 @0Ti@pP ?u(KX 4 T40 T00 vZ``?` d44Ut` 0S 440," P!,"4,2<,2,2@0,2,2 0,20(0@40U  x0S40 00 -0LA0P TpP!Qd,2  TLP0S 0<0b,Q$A}__PITI_ -h@LP\`0S HPD8@0S (/]YPITI-0 0/,_\ `P/0 !`8 00 (  , !/,LP 0!< 0`4 0 (   !/,LP -0L`@TP눠p QPZ |00Sp0呵d0P@X0P@RL0P@P T0 (($@p;;`_Li^T_]g_\_0 0 0/=dI -L MpXA{0%XS "N0ᬀPP(Ko`0F㬀"N 0 3o0 p@|0S [ 0F"NPᬀp o(KooS= -PL@ሑp"nⲀXWP@ t@4 8R#8 @L @@ 0B0D(2S R[@B @0B08=0@o/= 0- L  Kh/PR -LMpP`K` 0@0 <0K\0 0`@ 0 0 000 0$^?oP20S  R (K- 0-PL@0S0 -L$20CS$2("R Z -@0DML@0 00@ @0@0@ (+0'x0K@ 0000,00 (00!H0$@ @0<0 @ 00 0eK@=lQ_D=-HlQ_ 0-x0x@L p@RJ,,1(!A|H LPL|DD@@0 002K0h輹@=0R__$ 0 t$(Q6[ 0-@L4Qh(0S K0h_0t0d01d00S 00C00SK0h[?0S $00(0000 -`PL@P 101m00$20$241D0S 0 !!0`1\0X0P000, !  !Kh,LPP/P1S8(00S/ -@PL` P@PP VP PU 014A > -@4QLb v0I002H1

 0#K#`p #0##K!#K0n ..`pn0 <`00/0 $ CP00P0 T00T081S88A@= -4Qp2L@ q_ 0  BR 00 $1@0S 3/x|bմtPw@ h0>S : d0 < w (1S,!,!,1(! ,2 Px0P f " H1`3$05bh0T(0PE_0$0C0Z0S   E WUP!oE ` L10L1GP@@!0b0?o SD!0b0?o S `&$04$08aV ~>_ - 0L@04QS La$p$0F7S EP1 $0  00C00(0 S$0 $$0  0 000$00$0WG -L M`p4A40 P00 $00Dd0  PPU P;@00  P P!RD1SM U' H140"W R@!R@( R D!@! 00 B SP! }  & (K@!R 8Q40S  #W  $ B D!]d0  *0 0C S  :P 8!R PQ@Q@ -0pL14a PQ@T0S 0(D m0P1 0*Xa@غ01 /o -p PL@2P3: p@#@P5,@z@xP p_pK____ -<@LP0`SbP KhYT -LM00P K K]TP  0-LPw@P w@Pw0 0-@LxxK0hw -@40LP0`/ 0 ሸ0`0l]_ -PL`0K/@P5 0 P. 0 P' P0S姷jxP 0Sd嚷6wP 0S4卷Khx_,_k^8J_#_7_ -0L@ `RP ΅lq wP`wP `w0S ᵅ X8JH_[_ -LM`vPPP K%P00S 00S:KOP3><Ky@p刀T<Kyx2ᒅP x(P!<Kx@ꀎpm_^[R__^_:_ -L Mp0$PK,p (0 0`A<@0%0S V KmP 0-LMP,K?yP@,KCyT 0S :S /wK00S ,KxvP  KP  P   -@L`K/P p P pPP0S厶wP 0Sބ\偶7vP 0Sф,tKhKw_,_k^8J___ -0L@ `RP lZuP`nvP `v0S ង A8J__ -LM`_PPP K<<Kx@p崀T<Kx0U #ጄPᎄP pP j@PPsP<Kw@_^_:_ p-L$M`0P4K<0 8 JxP@@ CU 4Kw<K@P4KAxT UKp0000/ 0-LM@P6P 0 0 PQK0KP p-LM`P4KxP@@ V 4Ktw@P4KwKp p-LM`P4KwP@@ ߃V 4KSwP@4KwKpP 0-PLM@X0K0 00 K0 0-LM@PPK0P 0K0 00 0-LM 0 01v K|QQ -PL@`P PTp ~ \ `@ X0S T$ k  8J__4_ -(0L 0S  Kh8JO_ -PpL`@00(0p ` P@  p0@-@P0^PUPU  PU0^00 0@՜ 0-LM4Pu@P $000 uK0=0H S/P ((\\81] -%.L~m C -@LMPpK` `m K\ 0 0   0p  0 ` C0P?o20S 00 P0S0 0(K 0-PL@20S0o 0-@LT0t0Sl02l0v/s/|@ 0-LM 0@T6P 㟛0   Q@@   Pt! 垹t0@ 0h0@@00@ %㌭ <<K0hq (]=>0uKQ_Q _ 0-L8M,0\1@ 0T1P0L1p000'>0a0 00p(P$@ @cJ0,00 000p(P$@ @ @POJ/0 ,00!0 000p(P$@ @ @P;J00 ,00!\00p(P0P0$@ @0 @P0 &J$K(Q_KdR9__Q_000/ -0L@0CS0DP $`(KhKh= - `0 L #@T 0SpW 0KhlPl'0S RpLa0$ R@ e@TKh訚>=X 4 0 0 0 0 R0/> -LPt00C < 0 ,#0S  R0 R0/> Q-@L`@ \PTdP@P 2@0@T@= -pbL,MP`@ 0R * 0@ 0 0rp@ 04 0 T 4& D 40H @ 8 L 0 P0 < H00 L0 0 \ 0< 0 0 @0# P @<0 0 000000000W 0C00 pGD04 @ p0@D T@ @ @ t8@0@@0T@@x0s@0x@0@0_(K=>0u0@-x0 0  ^ @ 0@0000@00C@0 0@ R>=< 0 K 0-@L`|0RPS  0| 020SK0h0K0hX= -0L@2PQp` 0SR 0 0 0l02l0@T2U  R t BRQW l "l  @0CS 0l  BR d -L MS40 @p4 (LLS}   0" R``l   #P00 U  Rx R `P P,xQ TZ" RU R`  @ P40S " W DP"QZ|PRPi`oYppWpZPjVQaU Qa R] U ZQ x @ P$  P "    " ijl  l 00 0P` 0`  | R |"QppR R| |@P w PZ ( ZV U(K0 00P`PP=>X -LM@1pP`2 @㝏K00T0S K` 0R@St2 0p 5/@t2Sp" p"0= 0-P0L@1P41S d0 D0SaD0000 -\0\LQ4A@00S  Ob0P002Kht -0@PLq4Q0@0` SHH81SbT BY`0 <`0cXMV$KkG 0 ֵK0K0TK p-TRL M  n! b ,_0"BSN<811 <!!01!Q0X !QX2 uB,1 D03/۱ 8@! 0 0SL1 0 S00#0,1` ?Q( 0(1!0C0QP 0%g0` Q?, 0,000000dTx0`*|3bP  k$%Kpha(__K0>=>l*-L[O 0-80L R0t0@A0x00K0T^K 0 TK0 T喵K p-L M@`PU PUPU0PK0% P oKp Q-L@P0 Q Q) Q0PS0  `0庮VᶮP0差U D00S S`0  0 00CR@( -`0LP` x@ pW NgҲW$Kk 3 0 $Kk{$03/@ S1 -L\M@x  | 0 (l  $x0p D0t0 _\KxP0T T 0}\0Xh0 Yp`P=0sT0Ph0 l0d0 :`0 d0KL0 0 JLK$JJdH0 @ 8 D <@ z LKtSP0V0l  0R]@|0 0RS@3@C 0 l 20$01l0& 200S! T! R  VX!0\12^0 000t1"  R0t12 ]50N0000T1 -LM PS   40$ 080, (0<04 00@0< 80D0D @0H0L H020T P0 0%U<0@`00h@d0\0'l00p0`CGp0&~pd0<0 OD080 H0 ;PH0 0< KjP@ mT<WI 0 Y 019P0Y@x D0  |??orP% i0T00 00P@ WI0070t0 CSR`@@ @0H0 ]P@ |Tx0I0<Kj@P Y8000 D0 DK0n90@0HhD0K0 $0 D` @p z@@ =Q -LM4K`pAPP,0S ,!@T (PPQ 0wPP@  ᅑ$KP -L M@̪0 000㓬oK -LDMP0 0PX0 8@14 `4U 0s X04 `0P0(Ko?40SP0400H0 0ST0 PU 0S00 Up U0p 80 e>-P%(1`07`<0 4 <0 YD  @A\0 < 01 0!L `0 T<0Ss \0ATo 0<0 `0St0S h0X00 0P @U0媯00 080 00S~RRRRRPR`RlRxRxPP220$l0w0GS 20 R 0S<0Sd 00S0`0`@@0 H0Yh80T 00R0S` p T0SRX' 000000 0 000000000 0 0$0$0(0(0,0,0000040408080<0<0@0@0D0D0H0H0L0L0P0XP0T0T0X0X0\0X\0`0`0d0d0h0h0l0l0p0p0t0t0u0u0x0x0 |0|0000000000000000X0000000000000000000000X000000000000////<< @ A 1X1 1NυN1 1 1$1$1(1(1,1,101014141P1P1T1XT1X1X1\1\1`1`1d1d1h1h1l1l1 p1 p1^^a2 2aX2/2 2 2$2X#΅$2(2#(2? H2X@ H2L2%L20= h\0e`0D Xg7\0ZuD0 0D0 H0 0CH0 L0 0L0 @0S_ Z00 00S1B40ST 4 D00CP 0L S 3,:ዏ%ሏ< (KS 200Sw?QP |0尧W0媧0寧0媧  ^%[<<P<00@ >800C80 L0P N=00@0S Rq=41x00/41xT10/41T10/ -P(@4aLz200> -hP@Lp`iT4120$00aP2@0@$00> -`P@Lp`JT41200CP2@0@0> 0-L@0 0-LP@0 0-L@0 0-L@0 0-LP@0 0-L@٦0 -L@P`0S P 0Kh  0-P4AL0x Dx000 R04QxR 6/ -LMP4pͨ`Yu0@x7yIu[x ᄦPYy a0  tP @ pP p 0ppF0P  00 B00(KUP  NP  JPAP    : P   6 P- P(P ᓨu P VYSYppGgWYTYy x   Px -L M`p4P)x0@v5wGxYv PWwk   ֥P @ ҥP P PP0ᢨP   (KṥP  ᲥP  ᮥPᥥP    ឥP   ᚥPᑥPጥP x  Ꭵw  ፥v  ᆥ  vP -LM 0  K" 0-LM00  K -LM0tpbE@uBP=$0P 000K7 -LM 0  / K" 0-LM00 " K -LM0tpb@uP $0P 000K741`0#400/ p-L MP`'00 0@PPKphҧ5Kp -LM@PT@#@`4q2 ,Ka^0 ,K╞K> -L(M04a00P 唧@P 8K0 峢@P ?T@$Kp2P0 x $0R  =P 00/x0 0㍥0 00 ,>_ -h0L1410SP00SD0DpP@0Q@``0 S/0V; _pG 0-l0L1$" $" R @$@P$(2S 00@T*P  0-P@LT0 000000@ -`0L14Q0S `>@T 00P ΋@Ur -@L`TP5 TK TLUJ ||!:FPUS00V0S> 㨋H1`P1p4(1 0SpZ=& P% V* U&00P14Ap0@T$@  V U 0@$Kk@@ e@ " Z@ -@LM -LMQp`@S K@PM@@0 I@PA0S SB S@9UT0` `0000 0K[ 0 K\ 00 `00 0 010P@?o20S00 0@P 0 T0S0d PPdP#(KT -LMQ`Pp50S2 Kf@P @@0 @P (K茠K`  [0$",0Kd #\0 0P00 p 0 0r1PPPPU@ @@ -@\?DML 00@@ @@@㜛(_(? 0@0@ @@@N㎛ u 0!> `0B<~0 00,(`$@ @@ @|80 000!|>P0t> 0<040,(`$@ @ @Pd8; $00!$>0>00/> 004,(` @ @L8 0!=0 040P,(`$@ @@ @78 0!=400 80P,(`$@ @@ @!8 0h!/> 840 0<0P,(`$@ @ @8 0!/>̟ 40 0<8P0P,(`$@ @ @7 0̠!h<0 084P0P,(`$@ @@ @7 0!/>8 80 0<4P0P,(`$@ @ @7 0!/>˟ 0 0<8P4P0P,(`$@ @ @7 0̠!H;400 80P,(`$@ @@ @7 0!/>4 80 0<0P,(`$@ @ @v7 0!/>4ʟ 0 0<8P0P,(`$@ @ @\7 0̠! :400 80P,(`$@ @@ @E7 0!/> 8@40 0<0P,(`$@ @ @-7 0!/>ɟ 40 0<8P0P,(`$@ @ @7 04 ̠!90 080P,(`$@ @@ @6 04 !/>80 0<0P,(`$@ @ @6 04 !/>\ȟ\0 0<8P0P,(`$@ @ @60 400̠!70 080P,(`$@ @@ @60 400!/>h80 0<0P,(`$@ @ @60 400!/>0ǟ00 0<8P0P,(`$@ @ @60 400̠!60 080P,(`$@ @@ @h60 400!/>Ɵ0 0<8P0P,(`$@ @ @460 400̠!50 080P,(`$@ @@ @60 400!/>@80 0<0P,(`$@ @ @60 400!/>ğ0 0<8P0P,(`$@ @ @5 0 400̠!d40 080P,(`$@ @@ @5 0 400!/>80 0<0P,(`$@ @ @5 0 400!/>ß0 0<8P0P,(`$@ @ @5 0̠!D30 084`0P,(`$@ @@ @5 0!/>80 0<4`0P,(`$@ @ @o5 0!/>Ÿ0 0<8P4`0P,(`$@ @ @V5 0 400̠! 20 080P,(`$@ @@ @?5 0 400!/>80 0<0P,(`$@ @ @%5 0 400!/>``0 0<8P0P,(`$@ @ @ 5 0 400̠!00 080P,(`$@ @@ @4 0840/ 0l!0 <0P,(`$@$_>-_R _6_(YR>_BR _G_N_`_V___h_r___ _____`_T@R_R__ @ @4 0 400DD!0 <8P0P,(`$@ @ @4 0!00/>㤠00 04,(`$@ @ @P4 0!00/>00 04,(`$@ @ @Pt4 0!@10/>004,(`$@ @ @P0 ^4(K -8Q4ALp`0S S# S;V @TB )@ V P )@0S)T@D@"|0T@VB`)@\0PU `0S _05P2T@ P>> -pa4QL@D0S S2 SPT =PUN 3 @ n`kV@=T 1P8 `PU@  @ RT`|PTߜ`0PU `0S 0Ӝ0P@ @` 1TP+@@`>> p-LM`P V 4A @ ,KAV  ,KuKp -LMP@`0VM#`p## 0`  `p`,22 48<0@S, 4K8<K$P`p`3p30K #KRK$KP 0K#K 0`p`#p# 0  K$K -LLMh0 0D0 _/o%K, $KD0M -@PpP`LMPP IP ٕ@U> 0-@@L0S0P @0 R K0h000 @PK0h - RLMP`@p(K SR@pހ SR QPp P 0 pP0F@ SW>R>R?R?R?R @R?R?R?R4@R SRā SRāA SRā SRāЀP 0#KD040,&0ß,6 * SRK: ()#K SR0 ԃK #YX DHB0A A H 0 'V@b@8z TSRā8 SRā- -LMQ`@\0HSXPPE UT pWQ K0PH00 0q0P:0S- 0K` 0 S pK@ SX0\p  K\ 0 0 00 @000 0( P0/o" R0 0 0K0 0  60P 0 Q 0(K0 0-LM0P@ $KP$0K 4K0 -@L@@`QPpĀ0U$Kk݀ -LMQ`PU Kf@P @@0 @P  (Kq YP @@0 ˛@PP0@0@0 0+"D0K` nR 0 `00 000 0\P W(0P@?o20S(0P0 嚛@PNP`"@P@PV 00S.0CS``P @  3R a @@āq_ 0-<0LP 㨓@ Qx R0> 0 ȓ> @-c0;0 0 1^ 0#0# 0#  0# !0#( @as4,(000 0 0-@ LiQ00 0 0:00/00AS 00 Q 0A: 0/0Q -LM@p`PXI( &b,\1 \(  \!0( (0$( (0( 0 0 R P 0P:C0 0:0$K (K~Q(sH -LtM@pP`KU Y 0U \ KD8 @8H(KKJ-,(KY-K- GZ U 1 #0 !0R1pPE R!1 BR $ 00C$0 -0-8@LM ΘPP APK0 0-@L!.7  0K0h͒LA 0-@PL P I!h00l00p000@-0AC0C?o`p^n R20@a`_@^0@_ SA"@PB p-L MP`!"KYQ, 5,0%0A2 C0 C R b@@  BR bp0 @ @ @ Kpp-,  "p  !0/ 0-$@L0S0PP000? -@L,0K$M,K@#@)@0 00 8 2DRU J<`V&|l L0 {VPL0h xp, '}`p W1# Px0 W xp ) Y P p00wP@PEP`p R)0 ,00S(  r^ P,50S(%` 00prNO00h h0 00h L0v00h 00 00h Kr____ -@pL `WP0 T7 X000CX0?U0;0Eƒ1Q  > @@000,2S$00$0 0S PJEW0S𨝨D0 RQKh衇Q00T0pG 0-@Lw  00R    B ,"R$  B$ ?P ; @‚!^ R0A!4.! R0!R 0b /o" 0Q A 0 //(X` 0L\S000$0Q7Ó$0$0`0X09D \Q\   R\\  \  7$0 0-T0L@T@0 Q 0?S0;0Cƒ1@D00T00pG 0-L00 R @000@@@|0  /_0/ -L$20CS$2("R  -LM,0 0S000lw Kp_^]  -LG -/ -LMH1Q@Q80 0000 40 0040 00 $2p0 `p`$200   wZ Q.80(Ko0S00S>< > 40  UZ < >< 40 <>X 00S p -0L@q00SPpp . EY (UP= `PWV0$V `X- 0$KkV>-0 X-0 p -X0Q`Q ppP0LP@ P- -PL-@ ӎT@m= pX  Ǝ`u=T@$0" S ᷎T`0 $Kk=]= -`P0@LQP0S   ᚎTu-@<00SP/ 0///p<00S P/( 0 0@o//p,00SP/00//p00/]Ӆ -0ML< <0 4 000  ن0 KrR_A 0-00PL @000A @ 0-L@@P0 300A -LM@41Pp$[[.@N u0`S00 4@4/0042(K P4B0 3/4 0  -LM@41Pp$[[.@N u0`S00 4@4/0042(K P4B0 3/4 0 /00/ -0LMp0 0@PU(K 0S P `K` E0K\0 0`@ 0 0 000 0?oP20SH00S 0 00,,Ӌ03/P zpZ]_ _ -Lp& _ -L4M0`0S@' pP+@T"0,00 (00!0@$@000'> @ @0 0` "@P0W`S`@I KCPp@@pZuRtZ -L8M 0 000<P`p@000,(P$ a "0P R h $00   '. 0  0,(P @ax"$Kk$KtZ> _F _ p-PL M` 0@T T0@T  S  0D 00 #P (($o`KppZ]U _tZd04!@1<h  ςP d R00@"l !03//0@- 0S"@PB"00 0-PD@L O01S001  R  K0h0 0-P<0L14A 0D@ 0 0 2010 0Qo0j 0-PL@!0S0^ -P`@LT(0S$0(`00C08A - LD 0-4QL@t0S d0S00C00(0 &K0hI \/>[ 0-LP00C"0!300 @ 0 !A\  Q` *D000@TR0000PPP#0 Q0-L@ 00 P 0S(0141"2 0R00 0b0?o 0s0 c /o b0!0/ -0LP [ -LALPTp` 49$0 8$0.@$04$00F"l !03  (0SX@X t0>S0?03/(00CS*R|R@RRRR R2@T $@G  0 S 0(0000S $@@ %@@ 0-@0ML 00 00@@@@塃0P 0x00@0@ @@x㒃PPLT7 4r8 ,,K0hl{R _B _AȇR R$}R _ -HP QLK <T0廄`  0@8+CPB 0-[L@<P0  0K0hńB -HPL`8SP0 ㇄@  x+B08H@KhBG-HP0@!q@0D0H0L000000000111 1a  A @@ A⮒ Qဠ@ A⮒ Q& Aba䑖@Q$0(0,0004 d  d 111281̠ TP00000 00 0 0 00 00 0 00 -@LNP`@T  8A p-L M`P@K`$ @   -`Kp -PLMMH`@0p$4@ 0@ ,@ (@  @ "   䑘䑈$K   @@P$@(@,@0@4p 0$pK@' 8p  4K`0AA 8AB`02 SB0!!!!!!!!  $K$] p-LM`P4A',Kr?D1(H 1@U$00L1 1 ,0000,0 11( 0$0 10 0  PKp0E"K! 03P 0-4a001L0>P@00104!H" 4!D & 0p0(0 r ᣈ Kh(10101 -0LP@4q  Y (#` V  0`P 0010 10010A4" l 1//$04$0 -LMt0@0C P(K080 01S 8038 q<<0 h0p  Z' `P NPP  800C"0!a1`! 2 0S  2S02ą`$ 0,PK0% 0P   NC  N=@P41S t Rd Rp Q+ @ 幸0P Q @  B^ "yV S`P~ Z  ី@Ph  uPPC&0  B "^U1St0hPS[ d RU %&PUu 0 <0SP58Q?o22cN<PP^8 U R% PP8 QPU S0S00C00ht0d01d0R /1d0XP1` 80 Q? 80!!bR!X$]@BB -LMPxq4@`U$ PP1@T) `0Sx ZR000  00 000 bPVP  @T P @TU(Kx0S` 0  6P VP t0 CSR |@>> p-L|M@?x `KPd>0U0 000 x00t0 +<0p lP P h 0d0 Gd0K] =Kp 0-d0 @1d00t0000L00K0hw -pL`0@T% `0S d0S0SP`P GU CUV($Kk3 8@P>>A -1Lpa4At0Sd0S 1d0$0SP'd0SXP ]P 0Sd0S$Kk 0 A8QU 2>A 0-LxM@t PK=0 0 |P K K0 0-LMd0@60#R00SP 40$10 0\ Q Q Q $ l K0h -P`p@LTW l0  |@ p-L|M@`Pt KK=0 0 K0` Kp41$1 0/ -LMPP1`儒p04A& $d0  a_ᲺHOSWH000 rh0 + 0Rl0$/0 S @1<`܁p ^!` 00 d=00 rP` $1 `^0# (Ko/F280 1 4 40Q 202  (KopGoPrpW @0 00D < {p40< D@0 101101800 11 00 0(Ko(K> _ -LM1q Q4A?0 d0  x1Y `塃h   @1(K  R @alSYR Ppt KP<P1 儐 40 H K^⠐ 夀 p p1` ܁吠 < CZ l`~-1SiP $1. `@T0K 4/ፈ7> _ -`L$MP4A x0S:ڠ01 hl   0 P, (0 ?Ⰰd0 1d0!) us A$] -P@4` HpLk^`;"101101 1011010  E2 1!U ( !02$Kk$] 0-@PL0x (㨂x  K0h _ _ -LM4APd0p  $08$0 ށ  9!% :d0$`V0S 0 00߇  00C0\V$08$0S8a7$0ሴ/000 X u:1Xxq|10 i` X X!j |X( $03/ `j00S P ?Vx 0 `p <Vd02d0d0 :d0Ƨ`$ _ _$]-$]j] -LxM<1`At!4Q嘁R H0t!v2~X0201S" x1Sx K:` ^Kn:1܁,0 ~P 7$1 ` X0K 8/ Y& K P KN 0KP K$K -0`!L4!PH @"QܤRܤR8R8Rx@ pW aīW$03/8 $KkUi$KkL!. _ 0-Ppt0d0L1d0?`0S 00C0@TT(0S$0 J R 8AV   `(p000 -L|M` 1Q4At $1K0pS900 P1X@ 40 00 00 0tK␀ |0 0 x0 @90S : 4d0  pö` K!0 R @! ](Kh   S `H0` 㠀40`K1^v9  P $1.`@T0K 4/ !_$ t0 l?S  Q Rp 0S/ -LP@p `V p0 R 00@PX0`00@@@`p  @000/0S0S/ S  , 0 0!< 0`4 0 (   !/,LP 0-\L@PA0 @T000/ -,R00, 0$ @00 $ 00 (LQ Kh,RR0(t `0 0\ 0C`0 5( `@40(0PKhs pG 0-LLA  0( >00\0K0h4pG -t1taLQ0Sp lW> $0 G$ 2 @40$0TppW $@冇@D 4q X@P 01 @P 41H0B0@@ 0S 4 8PX ,* X@,P #@[$] -P@`pLQ 0ȀS0@T$Kk 0-P@L U0K0h 0-@LP0U0SK0hK0hw - L@`Q`Uʀ0!`` 0X P   !TV ,LP0t0| xR  0-PL@10S0n\ `P/0 !`8 00 (  , !/,LP 0!< 0`4 0 (   !/,LP -P`L@T h.`pn!X@0SP00:#003/0:#0 -pP0LAbP 000(p#  -AL M0p00 `㩿0 R %}@(K,\`@zO 40 {aP40\ɿ` R 0&%x00`q&&`a嶿SxZ!_R; -@`0L0P 0>00///N/-//// -LM K !K M;o K -LM 0K#  K>;o K Q0-L@ @P  0 P 00 0!_!_ 0-L@0P K0h茖K0h= -LMPQ@0 40 P(KU 3P 00E 0080 P jPP  I xKP!Z{U2PS800a0CQ@00 ×PP HP HP 04 800  0< H<(P$ 4!<` p.IP)HP$H0t0cR0T@< H<AሁI@ğᘀ 6$:&  04 0 H@ğH 60$:&  0_!__>_^ -LM3`P@P Qe 0| x p30S& df2P _^'!_^.^zd@!_ -LMP1y4K;@`pT 4K;*U "y yKkGPGPGPgGp | yUUGP[Gx4K:@HGPNGx!_^>_"_"_^ "_ -LMTZ@0 SD:00<:0S , IP$4 <p: 1`0 :JP ;@ :`P 90P0ST *}90S ?CS?}FP"0STX)0000 0s0  cR 0R00190 90A yxT FzxFP FPFP0ahxfxdxKqi00P0S F KK.P`@,0K0 S*R   CK0K oPP PP 0K KdPPPP +K FP 0w+Kᰧ%xX {F x|xK)i`P{X! $7`ǟ"60 0&p ?` pg, ,K 0,K 0 K+K 6&pWafȦv wKhPa$0P6@&0$F@PJ)Fh{FPLFPGFP 65!600az5Pu#% @2+FPt&FPonVK/P 0K KPRPa D0S ` /P hpP$K/POPK/P K390P D Rcw0$S ]wuPK/PzDQ 0 Lw0 h00#0 l3PUQT7 E HPP0E?#t0%|dPKS$EPEPtEqElK00`6L,: & 0 PYEpUE?c6(:&`p 0lK` 0PP4 8EPe4E@PZ9E'z*EPT\EPDWEP @202!600a z<2PBEP@=EP;a2 FPP  v10SU!000 K00D!#&00!K!? 0!GwKPP Kv|v00DPDP D _^^_D_'9"_E"_x'{"_T"_^"_Ā"___o"_^"_"_!_"_"_$ t0 l?S  Q Rp 0S// 0-L @0P0K0hn 0-(0L@SP |0xPS0PK0hx|0S0 0-(0L@SPttPK0h吸 -L~v"_ 0-PL@@0S0} -L`PH@Pp ,2(p2,2Ϩ0h1$00$0 @,2(p2,2P00SD0P 800S,00@o/;p\ `P/0 !`8 00 (  , !/,LP 0!< 0`4 0 (   !/,LP 0-p@MLd3{ \P\00@0N D000N ,000NK0I"_"_#_ #_3#_ -L MpPP0 ㈡0'D@l0@l`0 劷 @0 3<0 O%(Koc(KC -L MP00 MPl @(K  0(D@∑@ppl 4 N 4 D0 僷%0'V@8C -L M`P (Ko0VQ `0 %D@l0@hp0 0ủ@0  V@ (KC -P0L`0S D @,Pp0 $Kk/;C -<0L1$"R( R $0!$20$2/C-$0 C`p## 0c #@PC C 0#$V@P@3P30 P# R0@PC -@LM4KR `U ,r@p I,2 p0WR2pq( T0B?o20S $00(0 0(00S ,2S@UPW@0P"(2R ).22Uk 0S{00) , )28,210C1崁- 0S  Wᥒ0S?(10S 103/ ሃP5aU 101000S 000(x $K0So 0(0,2P2,2gAYV`0S` x,28,2yL[ 0-$0LAv0l0K0h# 0-00LAh0l0,28,2K0h -dadLA"(RU(0S 0(2$0$2S $`pd0S ,"@(20x0pS 0SP0l(`phh0,  $20$2k$20C$2IP[Q[S[R[ -,0L1$@P$(2S  -LMp P$`Kua%#0S' 0@(0,22,2@,22,2@R- 0S  0St00S h003/ y@`U`VUP0SPL[ -( L@R4Q R R0S 0(0Khӥh0  ?0S 000$08$00$00 ytr,RR 0( ` 媴U(0(0PKhH=#_ -aL q呴1@T. `0S 刴`00t R  BR  00t0P夀U 嵴@1S $$0 $ ( R }8Q4@坴TWj$Kk蒴>> -LM2"RY2b10100S005x20` @T~ `0SO +nᔠ8$ 4 P `  P p R$ (  BR RRRRRRR R 1Q% 4  #3d4 % 8Z X1W% 0S040fq @@ SR WV:po`p0x r0 xp Z QP*000S dd刅;n.#51@T (KowxGI>>^#_#_#_]70Pp@-0l@llP R PpQ#`V" 0RR ppPRR -1PP`p  @L0S 롅뼀PPH 0@T僳TP ` R踠ં 9 z#U4p#Q (AVp# PRRPR>@=/ -0 L R t[  R/ j[ -L~0!,20,2T[ p-@L MPP  |i<0`0S 0 DKpKphk[ RS-L Mp`P K0( KP`V(@DT0 P@ p-L@ MPP   Tj<0`0S 0 KpKphpk[ -LM8 <0 `@4S   pP!T`0S00SY ppYV0ppW P   00  sPP (K0000 rPP  00p0pS@%80S<0V P<08 0 Z 01PP 0@00CS񟗧DR|RDRDRR T0- K *PP-0[0 T0  0P D TMP P 0  PP a0 S T030#R0S UkT  \)0  T* J(]@$_ Q0-L@  0R_ST`000`0 P 00 -LM@0 P0 `4SU0sX0P R0 00 R "o000 ;rP0p00P R0p 80pV PKP0 KP<0S00 00 ? [0 B R  R AA0B PQ-R_R0 S 0 `8PtUpT  )40 Y+d0S JX D0S70S60<; S 00 ;0  0 SRL0  BPR񟗁RRRdRRtR0 0 S K&P0 0 0000% (K `P R  œ űP  PQ( S ( S N \ R \ FSD\pWAX0S>T0S; 9X`Po_ 0P/{S  pPI SXD0S6\P #P\0S  pP \P0K*lP ?Y \ Z8ER*"0P SPSXD0S  D0S X00P0 p\Q! |'0X0 D0S 0 0S0R0S \0SW 80S7P WR0 ZP P0p0 084s$3   0` Z 00Z-0wPWk ᑦh꒓!Q00 00 `08 0 '0 '000 0`0 QF:8n8`04 RK40 040K 0W0 0440@P4 0p;b0  RY 0SS S\0[00 S\000D0H0080P0SL 0(  SI0 00008 P@R `08  P00R:`B 0 %0 & 0P@4P8Q`  8 P 0Q:%K#\ ;0 0@( P0\0PE0PU\$_$_ b -LMP04S ` 4l@Q0s0S 0P R0p@(K0 00o@P0p@020p V 0K0 0K[@P` K5&84p 0[d`T@ RS K1 $P 1Z Z @``` 0 0  R4 RB@ P 0P ]0000 XP T0X0`p  K[&4 BT*0B08` B$04`8 `FT :`0&*`  %P4@@DT4@8,0@8@P0S$(00X"0 K00@`  R @` 8 P 8 4Q:P(0P$_  p-@PL MP0  lj<0`0S 0 KpKphIj[ -L|M0 00 00@p$R k@70S@3Q0s 㜤`P @( 0T8P000 l 0K0 0Ko@P40S` W`0 40S@ @@0 nP@ ᐤ(KT P@`0T%d0S ( S@2  00 W X0S OPv 0K0 ;4j@Pf b0PQ0p p@00 XP L40X00'0000 40S6r  0RV00 "4H+$XPM00 0Z0(00000C0 00  S @P 00B0 00C0 000s% @@@Y@T0k ^ڣ@P @a $070 4@ 000 )nP`P0K?. FiP +x$$_  P0-L+@0@@@P hT: (K0hS03/T[ r_$s_X[ 0<0/  P-L Kh?0!,20,2T[01,T[ T[ -LMp0S1004 S0 0X @04S8P`` @j(KU 00S0@S`Y!400 /#'000 %40 00S*0 0S   R0  0000 00000 0  0 00 zmP 00`@00S8PPV %_ -L$M`PQp 04S 3j,00K0 0t H@TP) P00Q1S0S RRRRRRx@00 F0 Pp 0 4/(KW<@W0@(@$@-@/%_RRR\RS`R -LPM0 `V@X0  0B S P XKbPP $KTpK!XbPP00S 000 p000X0KkPV  XKcUPU0S X0S P[ -LMp04SP`@ iT 0`0S0V0S`0 KPU -(K0 0 K0Kp P0HpW  0 0 @`0`0 0 07/X%_ -L|M`0 0@$R p BiP70SP3Q0s0K00 0K0 PP"d0S"W@ 41$1H R@ ,0Kd # D@B!@ `P0@ 4@800 `40 S0(K( ` S  PQ( S  800S  P @D RT0`00 0S X_Y `0 P``Y I`IXP$_ -LWMh1 0R@p`1  `Vh@`h1S0h!0T0 Z4040d1 <d1 ,0\1 0X1 XQ YX  \1 \! P,0K 1u Q 0s Kl1 Pl1?@uPP PE, K !  1(0W 0 d10 @ @ @  d1 ( W" W W`10000K@`0@ @ 0 SK,0KV/K(a#  P @P  KXKh`1开 0 $00 T1X @00KE0p>K KPPKKx P D0R0 sR j Kh@eP0Ph1PZPSPU ,0KV/K(a#SK SP 0`TX 4 RSX! g8``'`q p W0S`1X ZT1 p|PU8㞠PP @㙠P%ᴠh1S T1h!00S TQX`Vd1w wp~Pt  !0X@70(K@ 1!0p0 0P`1Q1P R+0p`1GKS  4 0X!0`l! LP l! ! !q!aZ 0`  0XGK00P RQ `1P0S`!jg`1  P0!p!!W P 0R0C 0`1p 00C 0 01P`!A(   f0@X0h1Saf}%_%_&_%_%_ --L0M0 00 P Uq 0 0$ K!0s  $0KPE #pK K  X@P RT@ KᄀKX |K`开  40 $0K0   ` $0K@# @ ` pBP@  8040 @ P0Q 0 ` `PV0Q S0 XP TPPt {PP 0 X 0 XP' ?@ -`L 1V`04S8@Pp& f$Kk  0P n0p`0 P fp`@48`0D"S*` Q0Q 8P@PT 00S`@`8P IP04p0pSV8pT[ H&_ -P0 LYf0 `娀娐q Rʘ,KoMf s@ S shBfT@ @='_ 000/ -LLM!4Kk $K?!,0K@RP`p`3p30EK $K R0$K#KDKx`@TP4K%KA!<0S DK4K000 <00$Kb Kp] Kh]'_1@-P( 0P:0P+227P|0% @ 0P 17P o37P-@|0@@@ @ 00@$0Hp01(@1 1(|0:0|0|0 0|0/ -L0@PLP0P0!`p P0R00 -LTMPt @` 0 l3PP0Y0Q2 P  Q S R*Q(؁ 0V$0"0p0 0`0 P`(pH0d0 0S S S  0R 0 0  `0 0)(K 0p0 0`0 ``8pL0 X੐h 0 \K 0!X 0## ᑂ 0&K%K #0#&K!&K0K %KK -t0LK 'Kt0؀ 0&K$KR  303&K1&K0K $KRK$KKR 0$K%KR0%KK 0 \K%Ka0 @(0K, K $K'_'S'_ -pLMP`K` @g0, Kd0"0\ @ 0 0` 000 0M@@P@T 0S0(K(0-#@RP0C0f0/ -@ MLP` 㹡0 (0,  00p@0004 HPD` @e?U V00 P 0d00 0K T0 PP ᘡ 00eԡKeᇡ(_(_l+S -@L₡@0`0@0e0PU #0 ᶡdKhjePd 0-PL@_0S0ᜡ -PL`@ i`P 0-XPL@U MMPMPFMK0hF -La_#(_ -PL`@T%PKhke D0`P -L$M0@`0 P0S; 8r(PU; 0XL#: Y P@ ^dHD @P R00P 0100K013ؠX  Zt!0 h;d@0F4d40 040P04000 eU嫠0Sᦠ 0R 0,0 0 0P0(  R( ,0 00(P 0Ѡb͠በ 0R 040 0 PdṠHJK(_T(_-Se(_ -P@Lhp0S @@ 0S@0 `V* 0R 040 0 wᏠc0 wYc0 ^!#!3 cP1$ T101T!1ec 03/0 0040 040@040MbJ( -@\0ML 00@@ @@@$W  00@@Khn(_J]J 0S-Lp@`@T`rE P @P `jEH0W P@ǟ@0T@SP P0PT T`P%@U )`HE@@H W P@]J 0-@L`垟%R0@P0ST T % $џT0`K0h EJ -0SLpPR`a`yPUL嶟 E@P PC0W Pp+LP# P3 L  LLX0PU,PS 0 0@ 0@!凟T PPtY PD hPP P DKD W P]J] 0-@LT!R0@0S   KT0K0hJ 0-L@KPK0 0-@PLKK@K0 0--L M$P@0`p $0 \0p00Fb `K -P@Lʞ`V `5b 0 $ 0Khu,b*Sw(_ 0-@@PLF 1 T!1b000 00-SLP@0:ᒞ00S ,0 0,0@0,0bK0hž0 0R40 00 000 @ 00-SLP@  S00e 0R 0,0 0 坞.00 0-L@PP00S0a -LxMP><`@Txv$K 0R00 0 p耄0S ( R,00CP0000 x K,00 00 00t0 0ؐ0J Ks>] 00-@0000L0CSh4 0S 0RD 000 ,#00CS  K0hP]]( R/0S/00 ] -@L,MX弝$HQ%X((K0<KS\w%$KK#KQPXU4PUPPHKdKKa\1ÌeȌ6̌USRB4` VB|和)40L0KlH0 s#?PD$K,@P`>.$K 0p$KPԅKU$K+  00  0  X OKRPPR`X0S0PS b0D D 0Pbʚ;]ɚ;ʚ;8S 0!< 0`4 0 (   !/,LP p-L,Md!@`aPVʀ0!`8!00!(!   !4K#KP0, K0CS<0 P K < U [00D0K0 0t]P  KpKh0< @ T R 4 ,LPʚ;Gɚ;6e p-@`P```0ML 00 @`@UL40 @`0@0 BKLKp]P(_(_ 0-8@P0LP 0m 0]6S SR[/ -LM@$K@bP $KTKQQP@/ 0-LM@P $KRP0$ K4K0 P-L@ PTp`0 QP00 0ʚ; -LM@$KPQ  $KSK -PLLM\0Kh l 0 `0Klh|bP <PX 0 (K`0嘡S0`0 X,0K@C@0` p#P?oX20SM LKhaPdKl0D P0 0 C\P  R00 00 ıY)`P` %K`Vp 0T LQ V0  P`p`AQ V0  yʚ;(_ p-L,MP` ,KR@P0S<0K0 ,0Kc@Q 0 <KSP@Kp -L(M@p`,K QPP 0S<0K0,0K@ PQ 00 <KRPPPK -LM R R S41x01 K0 R KSP12 -LM0@S 0Q  ,K,0 (0 R  $K$K $KRP K 0-RL M@P 41tx YT U  4KrQP 4@K/0QP K $KK0(_ -LM0 K -pQL` Ѐ 崚 0I 0 @P 0@R @TP=)@ - `ޚVP嘚H!0#0@_0( 1@01$Kkǚ(Jp]@B] p-0,ML00`@ [PPP4!P<KQ,KQ  ,K R <KPP PKp -41pL` G?o2!R0SH0!R儚00CS 0S 0SS0+EXPX@@TX@ @X@0]ɚ;6e -0L@0CSDOP%0XP0PSD_0" _0S'%0XPm 0R 00P eЅ WV.XX ^-R< 00S0@@ XP:000@@S  Se XPX  RX  X 0X`V peX X BRX `Vpe X R @@0%e`VpX0X 0CSX0`Vpe0X0]8Sʚ;ɚ;6e -XL^ E0A  T0%XX%0NQ^XЄ 0HP P`@0XQXUZ@X,0PE0X0 -Xʚ; -LMP@@0 CR5  R S4K$!cKSR,QQ 0 00!$KR R0,AQ R0!000 R Sd ``\\ %XQ 0!ʚ;ɚ;6e -L\M0 0p0 @`0 ?o2!R0SlK\K>^PPLlK:^PPH岘 0ATP=LK@@lK%0X0S 0BQ0*SR|K#'K 0%X0t 0!X0S  X `p 峘WLK(K5S |Ke'KP 0%X0t 0CSX0P5k9 RP&JZ@. 0 $RQ0 eJ# ^Q0 W  T(   T  , 0p, xptpp x 0 T0 @@D 0 T`pp pXpp,@K 4( ( N]] -LM0q K@ -L$MD p`/\P  (K'\P @D00@0 !00S@0S @ 01S 婖@01PU-T G@@0SD@  ( D 0pP  GRppPPH0 H0WUSlVStVSUS , @P@Ϡ0X $ H00  ^00S W W' Hp 囖T GI  <KP#K 0 X4%D0XQ1 e06%X<K]]ɚ; -L(MPpU`@4T0S T DKLP $K LKLP H0 qP D K4 -@LPT`<V`M `p"\ 0 Sd0\0 %X^X 0%10X000S0@ 0S QJS X` p De RX (X R 0 0 `qp0S ផ`$V0S( 0S%0S"0S0Ε$KkzHX0`p^`pXe R 0$Kk譕]ɚ;6eĨ^ 0-41L@0PS0\41@T U PU /d00Pt@T /000PgK0hz]0@-4P@ T0 R000 -PL`@0SY -1LQ 0@ PP```Q00$KkC0  0  CR+R RC400 0C?ʃ10R00 RC400 0C?ʃ1RC80# R0%KV&K/X0@ TP!@#j? R0@@T` !07 0KVO|N `0 <KĺT;00#K$K/40@A@`qD 4QW0ʀ 0! `! 0    !LKC 0!!`q0    !M(KM`X0SxxM%K#K040 ``&P @f .G)_,)_Q)_,LP<*_r)_)_*_)_ -LMP@U 4K0<0#K`RcK 5/$K0S `< H00 <0VR 4 K\04K3/갻 -LMH@0S $K"K0 P $KP jMK,`*_ -p@ L0 0aPUTe5@ NVP `0SPT Q5( -LDM 1Q0@S @0*pl0!(0 0 40K0,p$@ @@ @`D\\104 K00K,(p$@ @ @@1104 K00K,(p$@ @ @@ 004 K00K,(p$@ @ @@004 K00K,(p$@ @ @@\00,(p$@ @ @@00K4 K(K蘻({*_sS*_*_*_*__ -@LM`0p  0PQ "@K` 0 0 K\ L)P\ 000 0 0@ 00 0000\(K@T] 0-@LK0h 0-@L K0h  0-@LK0h -@pL@BP` QP00T00S d`4!M!40Ѝ/0M0000# Ѝ/ p-LM`0F S#*@\Pb,K$2[ 092K$0[@0<<,K$0K+FP@TKp -PL`LPEU@#0T090D0T@0<<0D -L(M0$00 0 00 00 00 00 0 00000000 L K*_ -L(M &4K4K K K螒^ -L M @K ! 0  "$  "$   @RK 0-P@LM Kz0 P 000K00K1[0E00K00K1[0E00E0 @ E S K0 0-LM@P `0b"!4b4#K0! P+(00 0 0 0@ S K0 0-@PLM K3 X0b" @!4b4# 0D D00D0 P D S K0h R/4!"?aAt R/00/ 0-PL@ᑍ0S0΍ -@0`pL!DM,PK@%(0 000,$@ @a@ @ '00S) 0 0 0 00,(00$@0a0@ @ \0,(0P0$@ @00a0 @0 (K=_Ml_O_zS*_ -LMp0` 0PR@V ?|0K ` 0 KL 0 0 000000xK?9  M 1`S-L@PkLp T  # PE\U  0zt h l  Q R/h R/RC44 4  4  4 /M 0-(0L@ CSR0S0P0^ D0+\ K0h0 57/ 0- L@R0(0 B K0h7 0-@LT0Œ8A 0-h0L@S00; S :#0K0h譌000000/J -`0LP @Zp0@ 0 BJp`0S @0@ P #僌 Kh7J//00/ 0-00PAL0 00K0hh/// -L M 0Q㌐p`P0P@(K4 00 :/@P`004  809/,IQU 58/PإTT*_.^ -LM!PP0 `pEV @80 4 :/`P4 80 0` P0U@ h W1 D@@ @8@M+_,_,_%,_1,_?,_N,_N_W,_`,_ -LP@`q0P 0Kh/ -@PL`U 0  5/0S` -`0LP@pU0Q Kh  R  R ! R -LM40 0p00 0`,0 (0 0< 8 0PU, K@0SP X 0S 0C8#8SV  0R 8PP <K@8 -LM00 K 0-pdPd`LM< 80 0 ,0 (0 40 @T, K P<Kc.] -LM@`&(0 c`(KQ$00$0Y90S0 S401 0S. 3/`P*40040 ,P)0X- 0S F`8K$VA$ (0Q.(0S+0K8K-`   D0(0S 3/ppP  0RP0WS0!WRG!(0,0@M8^u,_ -P@Lp:P`U Kh/6+P0p `008 0-$@LᎅP00P0K0hɅ8 0-,0L@SPDC+00,0@ P@  @ @K0h,_8 0-l0L@0PSK0h/*0040@ PH  H H40@0400;8 0-4@LBP00CSP00IK0hy8 -`p@LTWP 0,0S 0U00 03/*@ 0-P,@L<DK0h8 -Lp`P@P0C0S0010S1 10S- CW,d EPE0@10X30 03/40DfD$D D |EU 5/PPP 0R hP!U0R0US㾠E,_8;-_8!-_t-_-_ -LM`0pP0 @P @0 iKT 00S 00S CB4/d0,\+ET@ T pP\N0 K{8;]^Y -LM0 K -LM0  K -LM00  K  -LP`@P 0 KhDJ-_ 0-LP@P 0S00 003/0t -|P|`LD@Tq R0H0 03/ 40@04040kC`)8!-_ -0L`TpX 7/Pd@LPU E)PP0p `0P0P0S 0S P88 -4AL,咃`P0S0΃A@0S-pPL@T*U0T0LP)f=0P0 H p0S @@媃U0U  |$Kk@lF 3/0 3/@P R0P0  (8]8Fi-_0^^q-_h$0$$08S 0  FԄS@8 0-@LPH(T 0S 0AT (0@\0@@M -L Kh 0-L@BP0K0h -/oP"@@Q@TLpPA` PWP@PE` T4 / 0-40L@ 00S400400L0S 3/P 0-40L@  00S400400P0S 3/PT0S //%40L040/ 0-@PL0P0Lᎂ40ll`0400Sʐ0S$KkpF E m 4]o 0-L@KP X0S K0h/0X/ -`L@Tp40P" 0Sژ!Q 001 0P0 00dEP H00C00 $Ef Q] 0-@PL00CS00E ~K0hH b]/\/ 0-40L@  0S 00S40 0400`0S 3/P 0-4 L@  0S40 0400d0S 3/P0h0S //&0\h00l0/ l00-SL@03/0\0`0d0l00p/ 0-4 L@0S 400400t0S 3/P0 0-40L@ 0 00S 400400x0S 3/Px00pt |0/ |00-SL@03/0p0t0x0|00 -PDL`P@D0SH01S 3/@ -H`0@DLT Q&0pT PE0 S:eDHpT & 0P@!!0!0 -P@H`DpLT1S S@ R T3D@H@hKh&1GQ @ -@ LP @1@$ (   $ (  @`pTa T 8Kh\ h000QP03S (QP: 00R 0\ h000QP03S (QP: 00R 0@M8 0-@L垀0 0S S- SPPҀ0PP00C00S0 RPPP000 R0 RP@M -PL`@P T P @ 0-0L@SS00K0h -AOL@ |0|p|0x ``PU ?P0?@ P?-___ 0-@LK0hm 0-L@4 00@T$ (  B B$ ( K0hA@M8 p-LM`4KP@P4KU00 v@Kp R 0 R4K70QR4  h%PPPP 8-_ p-LMP`4KP@4KKp U 4Kt@P -LMp<K~P@T<K$KT `o W k `P<K@4` 040 0S 03/P U4` 0-LMP,KIP@,KMK0< )P ,K -LM`@ $0`4 T 4 4K"P@4K&K0$0SP4KpP 0 $03/P0S8 -pMLp0 `@P@0 P@P 0 0h0T$K @P p40 p p0 P _ЇSPSSS-_ -L Mp`@P@0 P@P vP X<@@0L L@P 0 0,0 K-_SS-_PSЇS._0/ P-L to/0@-\$ R P 0|@ 5S0^4C0200 R 0 @b34 P000T0 B 0 -LMP @RP9R#b!r0 "b0   R 0G40 0Z0S:PE | 0W  `` 00s S:W  p 0PC0PUP5(K40 0 0V*R<00/._ 0- b B30L >< 00V._ -L$M@ `RPp#T@@0(K |  0 S R 0` 0 < &bG ᐆ# I4  Z R B0  T1rp;!Y8  10 @DpR05 00040 00z._._0- b B30 RB  -LMR`pP U0(KR<6 S#B"0 R H P㐤# 0  I8 0 R R00C0 ~ Y  @@ 0 B4  W1r`r;0 Y  00P pG 000 40080 00._/_ Q-@LpT, TP"!bIX:V T0 pG PW T0 pT0A0U! -pP `LV:w"0@ p`Ph"0PbR 0-@LX"K0hS" 0-LM@PP 0 S  p  B K0  - 0-LM@PP 0 S{  K0 -LM Rp@00 Py (KoY@`(K4  @T00U0SY RR00"B`#180 0J40 00Y00U0S 0s U :@40 PE80p `P40 P -L M@P 0 S 00C 0K -L Mp@!P`T@!@ wX R BW Ki+ 0-L@PPT0@@0 R: 3P 0 -0LMP,@K0$0`Рp̐W 00S" 0 00000(K  0 P  0 Pp 0 00P 0^^^ -@P`pDML { ,0K@# 0,(P$@ @a@ @P p.00S 400 ,0L0(P$@0@0 @a00 @00(K谀//_PS4/_ -@P,`LN{ 0 P@ {谀 0-@L\={ PU Hz{P08 0S  Q k{0가 -ML M0P0 ` SlL9`dqd{X1@TU  R*BK+, @BK+ @<{BK @xz RXU P X  Q@@XU@@$T  T{(K < {\ 04`03/?/_]/_c/_0/0/0/0/ 0-@PL0P0$ P  0-@MzP UP0 3/0PP0` -QL`PP@ y 0U" ,z -@PPL`y(0S0(0  R  Khz0 -QLp`PP yP@T'0@"V y -LMD00S 80  KK 00!;@B -LMp@P`W P0 S0P0=$A(h0 0 0KT P ,7S06K/_/_ -P`p@Lgy0 Khy -LP  U-+P  M-, -Pp0LA40 D`P$20$203`P0 SI3`$@P$(2S 41 D/23/3/33/3// /////,/Q :Q   4@o/49@o/4/4!@o/<0/P8/@/ -0LoP@- |0x0 0^@ T000Q@0<0 0 S Q000 sȀ -LM<0 ?oP2``VpP8 @\sX4X 0 40 RWl 0S $4 44Q:0 SD1 @Q 8@ R@P@  `W 0S000S000 S RSR@d!RW@# q0 <1SRʾ ꞣ$@Q 0B S  P b!<02 0Qq0S @2 2t20040R 0 SPP0 @,1SS  &`R 0A S  P a!i<01 0AT@<004 0@ 0 0S*`0@`sP <I0P 00 `FԐ  1 P T0@ 8P 00@40040\0@0000r@(Ko30Q0 @rȀ]]0_]]0_ -P`$@L{rrȀ0 QP (0 $00S00//0 QP (0 $00S00//40 000R0/\ 040 000R0/\ 0 0-@L#rT00Sڤ001S 000P0\ 0S@DGr@0 < R0 AT@7rȀ 0-@PL@Pq H0D00Q@0\@r0 Ȁ 0-@PL@Pq H0D00Q@0\@q0 Ȁ -L MpP@$ Pq0 R `V. 00  P00# R 0 B RPUlqPh00S\001S T  Q0@0Dq(KPȀ -L MpP@$ PWq0 R `V. 00  bP00# R 0 B RPUlwqPh00S\001S T  0@0Daq(KPȀ -,QL@ T  q10S101S 000Q0\ Q `p(2q`p 00Sڐ001S 0|x $@ ZFp_`!@80 p ` qȀ -,QL@ T p10S101S 000Q0\ Q `p(p`p 00Sڐ001S 0|x $@ ZFp_`!@80 p `pȀ -@PL\pYp`8pV 0 $Kk/Ȁ -L@P`pP 0 Kh/ 0-@LP000$00 00K0h/ -L@P`pP 0 Kh/ -L@P`pP  0Kh/ -L}P -LuP 0-L@PlP 0S K0h/0 -L@P`pYP  0Kh/ -@PL\poT`8oV 0 $Kk/Ȁ -L@P`p:P 0 Kh/ -L@P`p&P 0 Kh/ -L@P`pP 0 Kh/ -L@P`pP 0 Kh/ 0-L@PP00K0h/ 0-L@PP 0S K0h/0 -L@P`pP 0 Kh/ -L@P`pP  0Kh/ -L@P`P $0 Kh/ -L@P`pP ( 0Kh/ -LP, -LyP,/0S/!   -L$MA(0qp#F0@9q@A`a0Q |8 40 tQ-408 d \ P 5/##K$0 S,#K05/V? Y$ (0R9ԃKB08 0  5/8  0, 0 0(Ko/Y#K ?x#K5/$00CσS 0Ġ ? 0<5/(KإT]T0_X_0_61_#1_;1_1_1_ -LOP0S -@L`P `*nl &n0t0p0P0 0T0`\PX 0-@Lf  3X0 -@l`LPpnH@T @ U@ 5/@7n 0-@LX7 P $0 0f~ K0hy 0-L@lm`K0hmXRXXXO -؃XP0L`p@00$A ? ?N 0SR T 0 P0$@ -L$M@c( 1PV"6 001 ‚dK00(K8Q 2 P帀 pN `n'3&8 ><0 0'3&>@ D0 '0p08!$0a ?#K00/`?p#K 0p;40 400 dK#K 0p`#KWVdK R0#K0 #KR040$K$K QP #K 0 SR06 00 ( dK`p$08 0 -P(L@ P:8 R `Ġˌ$8< (  $& , 8*5/Kh 0-@LMS    $0  0C?o2QP R\4 R1 P$K@K008@Q| AP"0K80 S  a"0K08SM1_z1_ -LfMp2PQ` 0Q 37Q00 RV \K!0# 0 WV $2Q) 2Q| 46C!0CQ& 1Q v QF1Q`  6C0CQ( 1Q_ 3C 5CQa  CQf/Q m?Kf/(0RE/ -0 S0;301&6`0)0!R!  0S 2      *! R{\x P  sz  ⭳Dq Dm Da gd@edAd@d@{dЀ|d -0`S<00@$b /o bP c0?o0cPT00L$H\ R 0S,1#!!p ]  R ("( R ("(w$ R 0B V  U `   hV$Kk\ 0S ^  0$1_1_1_1_1_1_TZ_1_ -80L`SP@(pW {{W0sf/ S R8SuPT Hmf/0d0?o0c QCP Q 0202 0P 0R*WEV -LMP Rp`D p@Ɵ$ 4&<p`PA@Kğ` 6$:&@#K ?`p( KhP  )|([  (@P( T L040 $0C((4$K>_] 2_@ &2_ 0p-LM@0P0 K`P\KVP 

h@ ;h0xp&w0K 0?00x0 ?04 ' khih @]k^O2_ ]>Y2_ - 0L@` h(PU 0S   0 Y 00,p0(`$ @8< 0!0 0'>00,p(`$ @8( 0!`0,p(`0T0$ 0'> @00 8(K8^)T_$Tl_&T'Ty3_ 0-LIM@!8 K0妥MKL1壥P-@ 808PPR R#@ `Kp*%  @;N O5T׋^3_ -@LPX`^P0!QQ0`,@^@ T9^|@N3_ -XL0S޻`@ڻ0P0d0?o0cs!C13/N -@LpTP` XPb`a圀PVpʀ 0! `! 0    ! 0!!`a0    !,LP 0 ; -0@L0pw|0|PS@<`EQ Y` џ`VT@ ~P,Ko OO -`D0L@`P@EU0Kh/ 0-P00L@00C03U00K0h/; -`@L0SP㍟PUT@ -PpT`T0LM@K 0$$P P ]40QFɧL]KPRN 0-H@PL 0U00  00$O\ `P/0 !`8 00 (  , !/,LP 0!< 0`4 0 (   !/,LP 0-P8ML00@00@0@ @@@0  NpP`Vʫ@xp V 0000$KkD0K@D0K1 !@$O3_ -\PL@pW0S8 aq @`X4_ 0-P@L0 K0h$O 0-@ PLD@ qT0$O@3 0-L@@P8P0UK0h00@000S:/$O00S:/$O00 R !$O0 $O0 $O0 r$O"1/"1/@-20pa @A t a00~Ѐ0-@00\!R S0$O,0 0R/Q0 /$O -0L wo$O-00 0R 0 $O <0Q/1S co `/ $O -@0^1 0 co ` $O-$00\! !0$O-$00\! !0$O-$00\! !0$O -@pP(0L`V红@P$O 2P 2f -`p@(PL0S𨝘Q W@$O -`p@(PL0S𨝘Q )@$O -`p@,PL0S𨝘Q 2@$O -ps`PL$M0 @T(K?@ 0?T0; T T 4 UP1@   |T`2:0 0H39 -LM 0@ ^t0  5RX 1  K<4  ,0KyP`Q@O3 0-LP@P  0- l0B ^\0 15Q@ 12 . 0 . `Q@O3 -<`Y R 0uY$Kk/4 -LMp`PPx@ 1l 00`000L3/D1` 00 003$K485_T.^5_ 0-TL@PXH0 0Q@  C B ?"@UY08 0-@HPLX0S00  R  K0hY08 0-P$@LX,P0P4PX08 -X@L`X0PUP 000041x0,0 0R8PPX8a0 -LM$0,P 00 M) K8 -APL` 8@|X 0QGPX8 -LM q`PdX 0R) p@T2 00S 0E0C@S@1T) T@# K00S0 S00X K @8XT X 0sX#@ Kf@P hX8t -@LPT 4`40H0X0P@0PSX8] 0-@0LR/ 1R >0R >C 0CR  0,K0h(0R :>0R 0`PW0P$PBU 0PXP00$ 0040 K0h'|f8~fd -LM@1p8 R` Px1 R0S 5S -@0@80(K茀K`  ,0K d #\0 0` 0 0 00 00@V@W 00@ WW0` P@圐U`1WV@?PEUP!U @ 0@S 0 əT0p`FP@8a0[ Q0-0L 0x@PAtP Q UӡUӡ ? P 080H008a0 -@8ML WG< f0L ,00@`\!p0 000($@ @p @`Pừ50 ,00!P00(0$@ @p @`0 ᨫ$K85_dMTPT5_5_ 0-`0LPU0P@00S0V$F40S L厘 K0h W;8t 0-@LP0SV 80S 0P080 Q P Q   Q  0S0@K0hV  R  ^ P;8a0 -L50舂 0 @ꈂ0lꈂ0zꈂ0zꈂ0  0z 0 zꈂ0 0z0 zꈂ 0-$@L ;VK0hꌂ5_ -L@P5V`0S 0 S 0h0jV5/T$V0L0q0@$K PP&%Q;P_T -`@ML@ S 00   0#KQ`T5_ 0-@ 0LP0 0Q 0 !Q 0-@L⏜0 0҂Q*Q 1/ -L`P@ R 4/Kh 0-LMP,0K( ] @ K0Q D_TT0 0E! -LM  T$0K*> P K -LM`p0p+T@@\ @ Q z@p0h s KX@ @PT RT00S P  ZP0h  Sb^5_06_ -LM  T$0K*唸P K3T0 0ָ3 0-L@M0K #0,(@@8P$  A JK0PfT6_ -P@$`LT0!5/@{6_ -LM\ h PP! Sh 54585: @R  h  K]6_6_6_ -LPMB0R01  CKR0`p@1 1!T 10000P(K101 !0R hCKT0l 0 0 p000 0 0 <0 0 D00 H0 0 L00 80 0 00 0 40 0 0 0 0 0 0 0 0x 0 00 0cK0 0cK|0  ^5 !h ?'K<1` X l0 @1d0 81\0 %K A$K> $K1 1 1\ 0 CKP1@1 0S1 #KK1#KKgKfKfKeKeKdKdK\ `P/0 !`8 00 (  , !/,LP 0!< 0`4 0 (   !/,LP -@L`PpQ00p0!00P0  S<<<Q 0 SS(@1 Pꨊ -LMP@p`  LP\ )#KK΄ 0 ! #KQP K(KX  R 8! 8! !.`p`C`p`C &K0O4(K8A8\Q@^ 0 KQ<<@] -@`tpLJ 0S l4/ 60S P4/.0SD44/X (4/U6 ͅ ^8 0~4/ G  4/ Ѐ#K G  0KR 04/00 1 111 1 ➿0100SW0 pRH`QU1P0@01Yx0Shh@PP0P00@000S0HX@$KPtPR;;(h:_ -L$MP`dp@P 0 00000 0 000000S K舌 -xPLp)Hh0` AT$KkaHD10D1\HHD10CD1a @ D -0L@0Sژ00SPG0pa101<181@10H1.$Kk)0 /;;iT -LM`0@S d3/P tpXHP$K0$`K0&0匀 PQ G(0S (K{8 00R0!0ES:< D00C, S:  J -@`Lp]G ;SQ 0@ 80S P0+`0P0GtGP0 0CP0 GW@0T   ꠂ -L -QL@RG` pD1S5 0R 0tP10 pm G1;G00yGPU Q 00rQ 00k=U <VG$Kk ]x 0-@LK0hꈌ`d /k -LMp`@FP᐀0p00 R BT1 0( 0 `p`L( K Q!`0( K5P -p0LP@@p T0 0 A`က0p00 R * @p @P@$Kk \!1: oP -1`0L@S 0P V00S 0`VP000p  BPW 0 R   0T0T0T00S W40 00R0S00Kh/p  -LDF 0 t00S/@Ft00S/zFt -`DPL/Fl@@ 2 @T P2@dF> 0-@PL00FK0hP> 0-L 0@ 0p -LLM0RX H0 0A?o20Sp0 0p00T P d0 0l0 \0 X0%PPpp!P `0X0 H0L `p X  cXX U0X /*X $ X #X X ,KH0 i0t\00\0 T0SZ d0P Z0#03R0SX00X0 P T-X .X +XpDX 9XX ` `0H✀ ` 0H PUXt XXM OX`A 00 H @0poX iX dX hX@`lXm nX jX`tXo qXj :sX 49YH L0s:   ӣP@7 L0 @@S0L0 0xXO zXQ uX{ - 00 H @0(l @ 00 H @p0 0`0W pN`L 0S`0 0F0c`0 0`AXX  *XX 0PL 4 L ,L 0H P.L k&X  lRX ` X  `llp 0,K@0i0H L0 L0T0Wh0 0 h00h0 ` \0hR00\0 70t0 0 PC/ WE T0S=Z0t0 S0p`0h PCU\0PL0@DTmL0@ T P`0h @CTT0SZ d0P Z0#03R0SP@D`) 00 H @T00-p@tPL Lrk   Q R-K S S- K-Kl 00%"0i$2>@P0   H @_   H @@HDH 0H  \g  \  b  @\  X, H H      0H0 @H  @@  @P @\4H Pl0 `0px VL @p,`|H @, H   p00H  H   P@0o@p @P#   H @    H @@ P 0P@00B0B0S00S000IB-0K 0CL@L0  0Zh00  C 0R@Ph h0U TC0@@C-0Kh0 T0SZ d0P Z0#03R0S 00PEUP T d0P Z0#03R0SpP T T0SZ P0d ?o2Z ! 3R 0  dQ0SP T0P T T0S Z d0P Z0#03R0SpPEP T0T0S Z d0P Z0#03R0SP@D~P T0T0SZ d0P Z0#03R0S00kP TmP T hzp0SP0 003/\(K:_c]t] --LM0@ @@ 000S@ @ Kh --LML0141l  2 0S 000  0 K --LML0141l  2 0S 000  0 K --LM00 0 0 K p-L MP@`]0` Kph\ --L M  K --LM  K --LM  K --LM  K  -L00S Khwp --L M00 6 Kb^ p-@PLM` K`"007TU 0P0F%07Kp -LPpᓄ\1 0S PA1S Z 8<PT +e!T,21,240040@0S10 0SA000 R 0 0Q000S`0 Pu`r0S X0X 0Q01Hcj|pp(K 00 W00S/ Q0S+ j)@T`@ T @@|KLt0Z#Z  0 0 wQ 00lK 0@'K@ l @T00 W D0   0 `4^:_ 0-LD D@18 00" ~K0hp c] t 0-@LK0h --@LM0@ @@ 000S@ @ Kh0Q  :_:_ p-`LM@P 0P 000S   Kph -0-LM@P@P0 0 00K0 0S q=P P@ 0-`LMp@  P80 NK 0--LM00 00 K p-L Md0@0P` 9T 0@ 00` kKph0KpFb^ --LM  K --L M00 8  K --L M  K -LMPx0`0p@@U 0P D0 p$$00SKh<KFb^p --LM  K --L M00   K --L M  K p-L Mh0@0P8S`T 0@ 0J0` KphKpFb^ --LM  K --L M00   K --L M  K -L M00`pP PP[0X @   0 X0 H0 pJ0S Ki KFpb^;_ --LM  K --L M00 J  K --L M  K -LM0P0`p@ @@U 0P D0 p3$00SKhKKFb^p --LM  K --L M00   K --L M  K - @LPT4qT`>X9?<@>01 0101016 -4QL`<@p1S𨝈!0A! 880R𨝘P? $1 q0$1,20,2 0d!Kh> -LMpRP 4a@>p0  <0Q!PE!( R>$KQP> &K,P >2[ p&KrK7P 0-d@P0ML@PD00P00 P 0Pm> 0 00 K0R(;_\_ 0-L@ 000 0-@L K0h - 1LP`V00S @P@0@100 ,  ->`D00D0P0DP01d>V0 t0l g> FP` ( `p`@@I>00p;SR;9;_PR\ `P/0 !`8 00 (  , !/,LP 0!< 0`4 0 (   !/,LP -TAL0S` =81PpU @`V 0S7$Kk= P  0R00 `000PPP P y 0R0D0 P000```Q   b00C0RS// -X`P𝤀0 !`!800 (  , !,LP 0!< 0`4 0 (   !/,LP -L@P`P@0S@ 0-@LP000/ -LP`@ <iP 0-@L^<~K0hz00/ -@LPpm`p00(0@p!0 pKhz -LP@`SpV0S00 R  T`0SKh0 -@LPp1`400@00 0!0 3Kh= 0-P@`pLM00(@ $P Q 0K ( K 0[S0Kg< <(KG;`T*/ 0 1\S/ / 0-L @<<000 -Lq?;_ -@RLpp1< 0SPP!R PP Q `a ታ 0 00 0qO<PPT -P`L<0S@ Kh=<0V* @T 0A 0-@L@ ;0 -PL`;@T00;P0S   0S <Kh\ dP -`PL@;P 0S @@;P/0S / -L M`P00 ;@pT 0 S00A0(Ko;;;@Y:;0140 @p;@T R 00A0;; 4(Ko R !IJ00q0 R    ;;T(Kk;_ -@T0L"T0!`|0T t0p0A`c PPP0pᲙP,0A@#c@B -L$M,@K<K#KKP`p$04 bK0CS$0 P=9K =$0 KШ -LM !Kw K K -L$M,@K<KӕK"K R0`p$4bKAQ$  R0"K00$0 KШʚ; -L$M,@K<K}K"K R0`p$4bKAQ$  R0"K00$0 KШʚ;0@-\0 R@T0000R0S $00R000<0?B0@-d0 R@T0000R0S (00 R00<0ɚ; 0-LP@P@!0 p-@PLM4`K 0 0 0St   #KP0, 0CS0P,   7 Kpɚ;6eʚ; -LMqP4 aB:T x114AT H:@ KE@ 940K00 [ 5:3:1 0000@P#K /,0B! 0㬀#K"K1B4a 9T *P :p@4KZ :#KH( !0P P @Y3>ʚ; p-@PLM4`K 0 0| 0Sl   #KP0, 0CS0P$    Kpɚ;6eʚ; -LM`@VPX 4`KLpP#X P 0K0CS,0 PT K , 4@KpP  00S`P @ !0Es 0 W0  ᇵP @嶕A@ P}Hu0PL0 0P0 P L00H H0 娮1L P00H 0FR0 80080 1"T0 :T0 000T0 H0 J !L0P P   H0@ CP L lP L  !L dL   <K aT0@ H`P PEPQ000 -PL>HH p-L|MP`U@ 0S x Kt00 0,@P l0 e, Ke,Kp> -LM4p40180 80 R@ 1S< 0S9 L@`T0' ?, ,0K$P`#00 UV000S  Y H0 S00i,@㌑I4PU=T0S00 Z H0 S,0Y O, (K0Y!LP0D PP0(0P0L@ 00L P0PL000  0@D 0C 0TP 00CS0T Z`LPWL P0RP000 L P0 @ H$P@QT`V K  8H -LDM@4!0L RK@ TKAP$0S 00 0-L@M41@L0PSK0@ TK(P 0$S $0S0 $ 00@ TK0 / -LlMs140\0 X0 T0 P0 LP t+l0K\ Kw +00 i+$@TX @L P0RP0(0P0L p 00C 0+0`i 0S014P0x   t t KL  p < DH 4 G 0 0<00@ H80 (+00TY```F`o^+$V phFP H+? 8  0L K :/ ~ <0 BS @  8   + xK0Px0   c0 0  x0 0 0 M0   b0 0  8HH?<_ -L,M@0BP *LD`0$`(0JPX#p K1 i?0>0h0 ``0(0K00`00pP 6: t*L0S */((`LP,`Pc*0U 0((0?0t0X(0* **d<_l<_U -LDM828p0 0S#@2@ 1lK 4Q@PL0?SXP0SU d0SP `0SMX X@T T> T@(KL@TZ *$0S2P*W6 0<0 $080 0@ lKL`40 @P =P@ lKh0HTp)ٚ0P 0R:%*H RL0*@L0SP L@(0WP0(0P 0LP(P0 0000A)WH88 b ^ -LMPU"0U2 00S#p(K4L0S L`0Y@0 Y ptP  ~ 0 P) pP0?S0SQ 0 pP Z)00CS0@)T >0 00 4  80 <0 804 pPR2)ZpY0SWp _pWpp8HH -L $  0  0 0,p(`P|}P 0!0 $0'> 0 0 0,p(` Pe}P (KHuP (KoHPt<_<_T <_8(T<_<_`T] RR  :/ -LLMt 4!LPU# SB 0p0 ?cpz'  ?`1R@00/@Tp0 S00Y0S#`'#`p/0@F(pt0W  +`P |((K0@!R 0S H0R $0Sh(@ lK`P<0S (pHR L0@B -LMPU%ژ00U!Pq `@P0 S40Kj@ 4Kz@P $K#@8 p-L MP`P @ 0 K@U 00Kp -LP@`ppP P" '00000';l0141@00ST*L00T *UP  P0@ P -LM  K -LM 0 K -LM`)P @ ( R @$K!pR @ 0 Z!4A, Z Z1! BR-@ 0 PP!R R R   @ `  @'`  ` }'0 P@@P @0@ -LM`P0Fp S,UUUpUUX P(KP "P P10 KPP KqVPP KP@P V@ 0 P 0s0 FxWKm W(  ]PP Y  ^I  >   P 5/PP  >   UP 00V񟗦tUUU\UhUUUUUUUUU U,U04@S\*@20\: Pp0 K yP001 0 0100  [P#000 S rPP㉄ 00C p1,`K 00& 0 03/PP0  "  0, K0" 0 03/pP 0 03/Pi 0@ @0, K0" 0 03/pP 0  000 0 3/ x00 0 0G 0 K\ 03/0P0, K<0" 0 03/P4P2~f}f3{f@|f 0-@LP p0 0 0-L@P0P @ 003/@W0 -LM@KP KkK -PL@`eP @ (00CSDU$U$U<U-@.0S<@0 @ 0@ -L M?@P @ (0S -@K0 `1K0#K"K0S S S 2Kᇃ 000 040Kp rKᗃ 0 040K @0@ -LM@0 ` T0i P 0R0b 0 #KP @ (0S 0CS@3-@# 10FS 0t00S @(KVpUpUpUUUU@@4 %4,`L%@CK@T P@ 0嘼@p0|`| @` PpVCK@P 000V 00S@ $0@0 0@ -LM0@0! wK -L M@ KjP0000K 0-LM@P KjP KVPK0 -L0MpD D K<  P8 0U`141@P ,P D0( @$0 ! 0 @< K04/@P,  R tT00#T0S@D0PE0S @0 f 0PK[ p-LM@P` P 0 0` Kp -L|MR @8 PP 0 @.Y (0St0S 00 @P0qlX X@0` 0 @P0 V  (Kl0K`0 \0 刀 x | 4Dt X141 0 R8|0 0 0 @ K04/@P|0 R tT  #T R@ X0B 0  R @  ,f^|| PQ 0fP H @@[ -0ML0 0O K -L0MPH0 L0KD0 0a@0 00 1U41pD0L 4P ,0 @2 0 @D K04/@P 40S tT00#T0S@  T  0lpb#1 4\#40PED00S @0 e 0P$K>[ p-LM@P`P 0 0` Kp -L|MR @8 PP 0 @.Y (0St0S 00 @P0qlX X@0` 0 @P0 V p(Kl0K 0` x 0 !刀  4!D t | X>h10SF 0  @ K0|4/@P |0Z tT00#T0S@ T  0 P"0 14\"|0 X0J0 R @ d0|| PQ 0dP  @@[> -0ML0 0? K -LM41P0 P `- @@ @fT l0 $ P 0 0@@00 0$00B$@p `V ~7V LK$03/< PNUPgbPNP<_1 -P@`Lp 00P0000 0n?@r?vO`  -P@LpA` ,XH00`P , $0R`0T 0-P<0L@T ,vP0A@U Q-L k00P P0-L l@P pP@@PU Hk@0<@0S v. g0@W]@U8UU -LDM@P T `I2@0@ @@@0  R2 @;0@"R,`K@&@!2p0 < 000,(p$@ @@ @s 0!H20,0<(p0$@ @@ @p0 s0P`(K 0!1q 0'> p00,($@@ @s0 0 0!1 0'>0,0($@@ @s0 0 0!@1 0'>0,0($@@ @s 0 0 0!0 0'>0,0($@@ @ss 0!0p 0'>0,0($@ p@ @_spk`P  TT4 `<_@UU 8=_ =_=_@=_+=_:=_H=_]L1U^ Q 0 U -@PLBoPPVP 0KTI]zKh R00  -`0PL1p4aH00CS@ @0$N@T PN| -L M@` 0p PP  Kh@P` PP0 `P M `J0P1S!!1! PU 02 0B@0  T  'U -L@P`P (0S \ U 0 @@ -LMp`P4 K@P K 0KE@P00S,00C>S@04PS@ 0S@ 0Kx 410 0-LM@( KP (P $K $K'K0 -LM@ ,K`P0 K,p`P00PS  ,Kє 000 0Q  ,K`K -L$M41@ 80 p0` PP 4K0KMPP80P@3 P:{@P4 080 (  ,< b R 4!W8 @  RR R0R Pz@ Hd@a0j/ 0R0 T 0W`0% $L1 0 0@0!1 0001@@0 @0pP< @  P ,⼓@1 0$0?(0L00 0000P0 0004 8pv04  T' (K  Pb< R@P[vo~wrτn0pSk/1@!@<`@PCV,@\]V=__=_o @UU p-LMP@ ` P  ,KP,KAKp -LM4 Kp@R`PO4n4w4P(0 Sr,0SH 4@T! 0b0?o0c 0A P00 R4 01S1 B"!,00C,04 T4 4A V 0  00P0S`   `^(K !T 00K `P `@0@ 040 2 0 0P"  #P<#(` -LM0K000@jP00K 0-L M@PP  $K.P$K(0K RP(00K0 -LM3P `R`0U S: Y @ `P (K2 gP K {`Pr]vU(`? p(0U, $0RJXj  0hh! @ 1@1ᨁ, 娀RfPU 02`x RP x K0 0| 0  | 0,00,0 A0I V VU (A  KvTG 0S 0K P `P00  P 0 #P<# 0S0000@@ P0P(`(`\ 0  @@@U> -0ML0( K -LM@P  $K>P$KK 0-PL@0S0 -p0La4A$1X03/X0hPPUHph00 Kh {P!KhT>X@ -L(M`Pp4A}P ` 1 ` 000h00(0K000000@0 `P }$K(0P10 C(( $0pt0S d0S0(000C0 0(0H( e0]dEU -LMp4Q`㫿$1@T PP#0P (PP 00 , 0>0 K 0 40K( PP 4KP K~ -LvP10/20/ -4QLp  `P @W0S $0   @ @P$  P P $0$@@G( R H @@ 0-P4AL  PP 0T 0 0-@4QL s @P @0$0$$ ( R @ @X @ p-L M@P4a H0 K@ TQ  K@Kp -LxM@p?T`@#4Qx K,00 x0@ t0 0``p $0  $^ P@ T K'P@ JHK> -@4aLP P1S@T (0S HQU000H15H1(0S   P1S 8ATP$& P -0P1L4A0!!`ppQ  PP  41SP1S  T0R $02$0 W@T -PL,M`RpH PP U0<0K0 @0KH@P (K@` 0젟刁4!p''D@@ e$ 4L0  $$  %@  L0x d0p0W@3Wp@ #PU  LE<@@U < KH@k=_T p-LM@P  ,K`P,PK KpP P0 `Q 0 9`P 4 -LMp@W;0 P0E Sp#*QU4`Kᆽ` {pP 0KV {(K @1@$$D@  0 @ 00 0 S 000S   0P 0 0t Q  4!RP!R 0$ "$ %V@T -p@WPqL!0P d@P ?T014a xpP  @TATQ T @ p-LM0`P1VPa4A K`P KpTQ,K  ,K^ w 0R #,K( -L M0@0KP KK -p@WL`@" 4DP $@F0SD 000 @T ]z@P0S ᷍@/ Q 0CSr// 0-PL@0S0 0-@p`@ML! $PK@%(00p,`$@ @@ @ lk(0S) 0 00!0 00000'>,p0(`0$@ @Sk 0!T0,p(`0H0$@ @00 @00 ?k$Kr=_@VUw=_UU_ -LM@pEi 0 `mP㬀嬐0 U:ᚉTP U 1@Pi$K0P1S 04K+4K]=_;@=_ -pLMPK8a` @埍0K\0 0 0 0P@ 0 0000 0c?oP20SP@-0SP)hPUP# ᡻p`U*0!R0W gD 5ኻP$. ჻Ph(K@;40 P0@1S //@ -@Lt01@TP 0S $ R$PDp0| 000l0`0V@04 a00C0 1 R0(a;@>@= 0-@0@@L P 3  K0h꘻@TU^ -0ML00` PP@.@ 0R pZ0 S   @ ^ \P0p80KP  @P cK@; -0 ML000@ PKhKK -LM0@0000 0 PPa0 $R8P 8 80S<P(K0ST `P0t00 " t!@S T $ 0 P` PapW@@耟T$Q  0KiP R P 80彸P TP(q 08 S ,2|CO(A;>@=@ -LM0 P00`p0(P@"z0S U@P080  !1E !000 Q4! Q @.@`(KuP11Ps@ x@sx@P @t aADP}@ 7w`@@` p@80S (0QE0!000Y P! R ; P0 B8aV MX Q  0K@;@>21P 01/ R // -`D0LAh1P\ATKhpq`@ 00-L8M000T ,00 H (0@  0 P'.$0 A0 0 phK0U=_ -LDM`0Td SH T A,0S W0h@0 d0S0H0l1pal10\0 \ H00`0 0X0 P0\Q`QX1 0h0 d0S pH0`T0S{ 0PB<KpPS\ `us``H0LP P0 %P0 D P0 D0PcP_oPeu T  0R;X 20S0 21h1PH0` T P0 RT"pR 0L  00SM PEX1S 0`!00 00S  uP #UP(K UD  D l0 Pe 1l0d1  2/PL l0 L pFP0P 8!F!dV 003/tY FP`f 0S <K0PX0 p`@ 0h S @AX1S@ S 0X10Pl00X @g0 QXQPP | Pw]U]h=_ -LM@Q p0(K31 "! ,R 41@0( 0 QTP>PB`RbU2`Fa0 @DVaYXW0AR KY  0P?X` 0P6W` 0P-1  0 00000  P R0  0  S R  0  S R 0 c 0 KZ|  0 嫷0vYXW`FLD K 0PfKP 0_ K 0PYKP K z0PMKP  K n0PATKPb K `0P3TKPV K R0P%TKPJP@ G  ᷈V᳈[ᯈ` p-L4M@P`  <K,P p-@L|MP`Kx ㏆` KP0 KKp p-P@L|M`x Kw00 41x0t0 A0p KqKp -LMN`p4Q kK\ SkKE  kKK p-LeM04Q`.kK@P 1@ 5kKF@ qT@Kp -P0AL$M>Sp`H0  ,0K #V4A@0  UHEVS MD0S DKjD(K0S0S`0  T3 0SXtUxtUtUtUl 3 0S 2 l0$]B 0-L8MP@P0R D KS,0KP Q  ,K DKP K0 0-LS>@P\0U4 UD UF 101 101 101 10 10R 101 ,DP $04$0 101 101 101 101 0B -L M`4Q@P 0R< KS,0Kp W Q  ,K%p <KpP K -P@4aL h r@ DH  L!0 0 Kh -@LM$K $KK -4a@L P@ 0΄t1vx0 !! !! ! 101CP "$04$0^ KhZ B 0-@4QL  t1S zCP $04$0C K0h? t΄vO Q0-L @0 UP 0>_ 0-LMP@PQ$KK0 $KeP -`4qL@ P V 0! ! ! U` 0` 1 ` 0 S `3:0 ! !01  0-LMP@P Q,KR KP Q K4 ,KP K0 -LMp `WP4 F K03/@PK@PKpP-K0p0SppK*g^ 9/@Px2x!K夐K x!|! |!! ! 101` F = 0 NAP v Qs0 0lK1 0  APW ` #@[ꔑ41b1S41g/!04a1 1S PW Y011S!!1! < W4 yWY1Kf,K KP`p0 kK0CS0 P  K +K KP`p0 mK0CS0 Pp  K -KR0 K 03/Y @ (K` K03/P@ Bʚ; -0LM( K@h@ 0-PL@ 0S0 p-@`L MP K a@P 00  GKp Q0-LP@ Q Q00P00P h0T @DTt0 R0 -LMPrx0 0 0Sk0@ShP AE HPP 0(K 9 y `0 t 0@114Q + @T0 00S P10 S;xy php00W0S j0 00 O Z000x` h0Wt` S` t`W`F0`p 0P 00 I00t0hpV 003/<8A0> -L M@ K fP0KrK -LMp@P` 0004! v`P 41 $K tPh41 0ISPEXWP -L M@0K KP  K?PQ  K7K -LM0 ,K (0 PP'Ay ,僮Pg $0S(40%pT` 0S" Af i`P Pd ,P (K(P $K O `0 P4a C 000 PP@ w Y P1 S(0S 8AT e XPP (K,P ڭ,00fp(K,ͭ0,0 ;> -LMp P K `@PK`P@ @@04! P 41@ &  妭K7 Q ҭ.41    宭@꼭 -`LP@v0S@ @S0C@|``0 V|0s0C0@?Vt0`S ʄ0h@0T0 |0V|`ŀ`@@ -LS 0-@p` L!DML!@1,PK 000p,`($@ @@ @@%)^ 0!00p,`0<(0$@0 @@ @ ^00S! 0!0 00,p(`$@ @@ @d^? 0!\0,p(`0$@ @@ @0  ] $$(K =_P=_=_=_U _ -L M0004A4/K -LM(0100000A4/K 0-@PL 0S0K0hJE 0-P@LP AP0@ 0-P@L 90 00,03/P 0 0-<2LPQ@x )>C 0CQs 0CQZ 0Q0 !40iS 01 0(011K0h/1Q\ 0QT 2=C 0CQ0051Q( 0CQ 0Q0!S0 0 0!!01Q 1[?CQ2 1CQ TK0h;g0S1::1P0Z0S: R*0RS0C BS00 TK0h 1#30<RPwt@|s@~fvt -dLPP@`20  B?" 1R@0@P1B @@V^X 0-@PPL@$1S0$1  R  K0hF0X 0-@PPL@1S01  R  K0h.0XQ0 !88S0 00C0C0CQ0C 0C3+C? R0/ -pLM`KP` @.0K\0 0`@0 0 0 0000 0U?oP20S(KQ0= S// --LM0 0 00 K^\ `P/0 !`8 00 (  , !/,LP 0!< 0`4 0 (   !/,LP -L1LP@ `p0`00T1x_PTPRP U T1 c```f x `F Ɵ0000``U@ `p0`00T11 !c0 ? R1ꘔUUxUUUUU U PT `p0`0x P  U  c?0SxPS0C°0L!B00000X^] 0-0L@ T15T1T!"20# P00 0@P U 0@SK0hNU^IU@? 0-P@L@T08; 85 0-L@;P 0S S 0@0\H0P4p0(0@0I_00]X]  - LV}] -|1LS 3/ 0-@,PLH0<0K0hX 0- 1L@Rʘ$Ib0 p-L M@^P c @` KPP` KPP0 :0c?N Kp E K = K -L MP1T@0S 5T1coR \ KB/E BRC00C08!P ? RnR K@  \ 5p*T1 >0(K0PPT15T10:0PpPGUPPUJM(( Kg [ 0 :0\:]=_0s/S/ -pQL@  d`dA!P"R ?0~0B!?0 S?0~0B?0S0? ~0B0Q?01 -PLM Kw Ks Ko>`V {KKK` KxKp@@\Kx@KKK@pKx@HxKP\KN@KLX -@`pLX0n@P@00 ]{P$+ 00S X -LM00@Tp @T @TPS& 0 S* Q` 0S`  ^P``  0S @|PUY H03zd2 `ke2c [ 0" K K:LT ] `x0" 0?0K K)L xTPUZ0 KK`P& 2N- R +K1 K00 N=0S0 *K1 K00  t0 R^ 0CS[D00846#5d0bl b0T0bH!d0Kj KK(Ka# ^ Q|Qz Px [  Y(0S S! 0d K L0 DK K80P K0`78Q|0d dL0K,0S 0&>_7F>_U>_M_?BH'k>_=_ >_c>_^:_rM^ -jLP@`0P1B @ U qnc@VX 0-gOQLP <0 8rLP00S0\ 9X>_ -`L@PV 0P @R00PU(` 0 P1B 0 0000PP0C00 PX -a L0R@PLpŘ PU 0 PP0S꼻 -P`(@L=PyX 0-LP@P0 0cO00蟢^ -LMA̡@ @TT0Q(K p1PcP_o Pu0a0?o0cP$ !P E12 1"!10CS1!1R!101! U؏ #W( :W* pW 0Ta0`0  0 KpKX  g<X  Y P <>X 0- L#P -`L|M@p1XS 0 0P!B @  (K0< #" (6204"Ql0 R T! e9P2 0Sl00`0`H20 J ;0A2|Z 0 S2V dQp1dp# KP`pK$VML1c( ?0!I0V"0PQ대0H0 T1p`F0 SB0 S58d0  x 0 W0C0p`F00  0 0P00T10 Sy0VQr T1 0>0<A DX>] 0-H@PL00,0   PP000K0hX 0-@DPL000C0 0R 00 K0hX 0-L@Pxm n0 (4 @`l x2 0. 0I.01111111111110|U>_>_>_>_>_>_ 0-Q@L1/01111111111111S !1R 101! VPSSmma T@RxP(v4t`rlpnl IK0h艦>X -bLML  (A s 0@Pp;!\2,K@(,0 00p(P$@ @@ @PyU0 0 0,!1 004p0P(P$@@ @dU;0,00 0 0!10 004p(P$@@ @NU000;0,0 0 0 0!P1 004p(P$@@ @8U;0 ,00! 1(` `0 04p0(P$@@ @#U 0`!0 0<0K0p,`(P$@ @@ @P0K0@ U0 00!p00h0,p0'>(`0$@ @80K< K0KT(KX0U8U'_>_>_>_>_>_n_U>_ B 1,/011 S!10 !u0AX 0-@PLX 0U00 00P1B  >0:PX 0-@L$ 0  (K0h3 0-L@P TQ @Q  c? > 0>;000<0lQ x $IK0h 0-@Lpl0 R  g/0@000P000U 03 0X> -PL`p 0R@ @P1B  |AT 4/0 #P@P X 0-D0LP#PP@ Rl 0輻X 0-L@ $A[~0X -L MTa@ P<00 & " 0 "\00\0! 0!Hq4 00$0S P % (K" 0 "$00$0 R P @   Z <0SP  P14 0 TS 0000?Y$0!T1  T0SH1  eP xP000MP1 1S 3/P0000  〠  90 7 f1 C/oS" R   ^-*090 g1 C/oS" R T15  0T s .T15T1(Ko3 `1 S  S Ra1 S  S R V\ }`1 PC_oSRPU  Wb1 S  S R V@ a  - e1 S  S R 0<0Ỏd!0B?o2 RPPU  d!e1Rd1 C/oS" R T15T10<0 Z   < S[1 S  S R 0S 0  Z@ ]1 C/oS" R# c 0 R P    Q 000S0>;) K \1 C/oS" RP ^1 CoSQ1 ` P P p p0 P P "l@wp0 P P V  @ X j1 C/oS" R !T 00 S   1Rpl^h  aPb<S? sY Zc X1 S Y1 S Z1 S+ ) Z' 0 0@^$0  :0/ OX1 PC_oSRPU. , P PEUP#U& PE0 S > X] -PAL`KP @ X -L$MT10K2T10@9000 000K& P090K 0-T1L@ T1T 00h1S0i1S0 -`LPA@ @p 1R@ 0P1B @ T Q W@ IPX -TL@P`8kU"R0X -LDM0@ST d `(K0 `#K4t4 1` 4@T1P0  ^2 Q-l * S' L413Pl02 0Sb`T] 5U3f`LV P0<X0 yiQ0\0 Uh!01RF0P -h \l0 U PPl00A Z0S;H1  dP x P000P1) 1S& 3/P000RP5 SRZ<KV0U`0 P  NZ0`,P!B )@' @V` R LKVK 2d$K R D 40@.Z+Z0EPSZT0S@0\0 ڈ0*X0S d0  #`%0 (`h1S#V V#V% icQQP h  R P0 $P0Sa 0`P[XX 0Q0R0Q00SM~Tq`6VCT00S? X0S U: X1S Y1S Z1SP0  U,0`#X> -LMp.@QP4! ( BQ*(B BQ F"B(BQ  B%- R#-Q  B-QJ  =!4"\w p " l-Q gl BQ: Q U <-U 0-U $-U =U" 0CU 0U %40WS!VS*KS  |볼< `V  XY!üV $`  06/p,`JvOT [뒼L< `V  X8!ᢼV $`  06/+`)/+Q ++ Rrl R " R} l z`1PukD S 3 KP+`PZ (K(;U# 0U}`+U   BU :Uo *0T! p %l8Ue 0U`T(V0p TS 0H0HS`* $ePP `% 0D 0 0 P N K k`Pu e'U 7U0CU6*0CU01787U 1U 7U]_< vP  p y60Sl 70S `P7U`6LY0 1Ss 3/`Pn HM00H0 0C0;<PUPP3"Z`ZeV@T`&0 >00S00c0 _@0>_6Ct gt>Gt ot nt ct@t@wt@jt@t@ht@ett,@|f}f\t`t8_vtmtptt, 0-P@LVU0  @  P1B  `0000CyPXX/X!/ 0-H1L@ , e1PSPSPU 0\ P0<0ᶄP 03/d1 S S R 0<0|1S |13/ =#PX/ 0-P00L@T0lP @/ 0-@LPD0@PP  80P00S 00 0 0X 0-LPPL0@T 0S 408 CTT 00 00@X 0-@PL0,(0 8 TT 00C 0K0hX -L@iP2pP( OlP`000 @R 0P煁Q 00<00S  R  0P`?X@] ,-LPP |>_?_ 0-@LXSiT1S0 00+@Y00T1  0 1W 0CW15':P0@0P00W d0CW H1< e1Sd100C?o2 @ S> P0@ 0 0P0 4X00SS-P0@ 00P0 `t0Uit_t f@u t tptXut\ `P/0 !`8 00 (  , !/,LP 0!< 0`4 0 (   !/,LP -P@`L`V` UBV00 0P 0-@LP DP 0SB;0000 0-@L0SP  \P 00BSs 00lRQ3\000 0S00000CS0000 -LP`bpV0SS 00sGT @@DV@ f0`Fp0C00@ 0@T00 -PL`8\ @ V@@DT @@DH0L0A0 @ l@^ 0LS0SࠡpspphR^  @R  LR  0-@PL0S0000K0h 0  S 0C 0AU0 BPE0S00 0U RR   -@L`0 PSS 0SK P0000`\ 0BSs00aR! 3 C<  !0 0000S000j?_ -L M`Qp@Jڄ0 0 SA S0S4 000 0R5P 0PPC PE0UP e R  C0ࡁH P ⬑:50C0`Fp000P 0PU00Vpѫ uP 0X(KN 10c00Z 00?_-0S000SQ0CS0 0S^ 00ASs00nRP3̌ꌵ-0h S0 0 ^  0CSs00nR\3, 䌵 0-@L RP @Q  BA0 \P 0CSs 00lRQ3\R  0 0-@PLp040141l 20 P /0-P4@l  P00ޘ -`h0P1L41l  20 @T 80 JPፚP -`h0P1L41l  20 @T 80 PlP 0-L0P41l  20 @T 0ƍ ဗPN0P 0-L (4l!  P | Q  Qh@4!200R0l@l@L0K0h@@at > -P. 0-@LH,$0S 400 S   0 w0萵 -L M`p唐@T YbP$~]^TPPPDK_ DK(4DK@0S$K@ꐵ?_0S/%U -xPL@h`pW V0`D 0 P@&bPp 0-LM`0!@0P,EK4cHAEKz_Q AKu_,EK%K0 -1L@/ H1S,P1:1(1<`S 1(Q,Q:11 01l)PHaPU 0S 3/P ㈑ ㅑ0$H1I -PLM@sU 0SPK,GK5&PP GK QKPK)pPP S0`S 1[S HGK^1 H1S0Sp1Ha:1CK3/PV P ) &$IP 0-L@L(P|WyW0$ W0 K0hW꘵VV 0-h LP00P0X0@TL0LK0h|WP0SX@$0S 3/,P꘵$ 0-l LT00T0\0@TP0I4K0hYWP0SX@ 0S 3/,P꘵$ -LM" Q"  "  R P㴒@P 0" 2 =k`P= P(Kp2@22 T 00S, (0S)PU& 1"R" 0"00R000 0ګPd2Y00X0Sz  " 00"S @000 0S00  0`0114 - Ka 2S 嬢  R " @ " " " !t " l p" h" Q cKd"K K b R Q0 WK a2KS H L @ D 8 < 00 40 -KPSjZ000 U 2 I =2 0Hs } \!K"[!KP$᷸2S22|p =;<<@-Qp@P `| @i>Q`0 @ 00-X00L@ X  $R|01X0S 3/P0ST0 R D 0 08 04 0c000S 3/,P$HDPL -LLM0 0@Ppl!2 000,P(p$@ @@ @P`p> 0!`2 0040P,P(p$@ @@ @P` > 0!2 0040,P(p$@ @@ @P`k>0 000!1 004,P(p$@ @@ @P`xV> 0!pp1 00840P,P(p$@ @ @@ @> 0 !1 00840,P(p$@ @ @@+> 0!000 084,P(p$@ @ @@t>l;00S pPp`ppU:T "(KoP 0"S@ (K^?_?_?_^Vs_s_$P801X0S(00S/ P X0꘵$ -L0P  0B?oR20S,\ 0P0-L@ P00^0 R\ T\RP\,00 0-L@P @0S K0h/0 0-L@P <0S K0h/0 -LPL -LP Kh@P0ӗ/`] Q0-@!@3PLPP@0 -L0 S ɦ Kh`x]?_ 0-LP@OP  H0S K0h/K0h -p0LP @6P D0S $Kk/`PV 1 !P @TfPF舀X B BR ! fPUP!Vee 0- L@0P0 K0h -`PL@P Kh/0S% S S  KhVS S/0PES@# S S 7S S Kh10\  Kh< Kh KhV:_?_@_?_!@_?_?_?_^ -`pD0L@TP0SX@0S 3/,P$ -`Qd0Lp@T0 R X@P0S0S  3/,P$808 0S0C1 S1 P #/Ժ80@S/  -L M$0 K@rPK[ -LMP`Kp` @^ 0K\0  BR--00 00 0@` 0 000Oo0 04PB@TQ!0S S S lP0QQT<0P 1(K80(0'$00ꐻ] -opLMOK ^p 0_Kd$02 库` s^0P 0 00000|B lb 0 0Z4(KV 0-1L@SHPL0S0L0 LWP U0H@0 100K0hUH  L00L0H0P D0` T^ X0\ K0h/1@_\ `P/0 !`8 00 (  , !/,LP 0!< 0`4 0 (   !/,LP -LMP0@TÜP0,"a!,"p @T!,210#,2 00 0K`0SX@(0S 3/,`ODT 0K0S 3/0KR@BT$ǁ 0-LDM!3@`p'00>P< ` ~U0`C` 00 F00000p@f]^ -0L@p  PP: (  0 0  000HLNH0H0@夀T9U`P `  0 0 000HLNH0H0@UP]ZA_ 0`( "4`#/ 0QS /P cP0 (/0 R/ -` L@ZT  R@AQVT PPEUP! T`F0@ -L M@P`@V`V 5/||p`-0K  P@-[ 5/V 0D85/ 5/5/5/(KqA_5^^.^ -L$MpP@~ @R 04/0 (K40K PHL4/3[@d#dhFh!4/V V* 4/0 4/3[#!4//[4/0[4/2[d#dhFh`F!4/V (0K wPx|4/2[([lT#4X4/([%XQ@ Q QH84/04/,1U6 $1U5  U4/4/1U% WU( 60CU !U4/0 q K0U <U 0U 4/ ([4/|4/0 D4/J]A_A_MH_H_oH_5݆aH_WH_#H_H_!H_A_H_H_H_H_H_H_ -LMP`p@@X 0 4/0  $K,0K P4/PY,[h(4/\4/X+[4/+0[ SH$ S< S4 000K P#[ P"448C8S "[4"48#8PeS S4/4/2[#!4/2[#!4/+0[ S St4/eS SSX0 X]H_A_I_4I_FI_XI_@x^]I_P_bI_gI__lI_I_I_I_ -LMPp`@G @ R 0tt4/0 {;,0K OP484/, K( 4/& K 4/2[P#!4/"[4"4 8#8S  S 4/ S S4/0 K4/0 ll4/0 ;P4/0 h]A_A_TI_I_I_A_݆dJ_J_ J_H_ -LoP \`P@Q Q Q l4/0 KhQ $Q Kh] Kh" Kh Kh'J_/-/-/-//-/-/-/ 0-@L -0 -L S-P1P!L` Up@F\ U l l  TPU: -L M0p 0`PP)@ T01 0!00000P T D@@ Z 0 0 00P Z J0P@H(K-/-/-/-/-/-/-/-// -L@P` Pą p@00  MX  N`Wp  MP -LMQpP` 2Q 1CQP0S P$K09Y@I   80"@KP 0  9 0SRLBT=@ hWq $2WA 1CWZTK@P P K K70(QPUP#W 4PK4US@P PU 5/PH@D@DT KPKK0p LB T (1S90001S0:0 H@P00S H@T D@DT@1PT (1T 01T kKePii -LM`@@@p PP 00 P0 @P g (K -@PLPPU`@ L`P -Pd0d L0 0AT 0S`o0S@$00$0W@V -@PLpY \L0 <0R) 4 R) *`00@00D0 0(0t`|`p00S0x0$00P0:0/`P@@p -@Lp`$4P0@bUT  Kh_ 0-@LP0 z000 0-@L@(Fp3 0S `y0PS   0P 4z\HK0h}zVV -$0LP0CS`$0@80000?o2@T vKhK 0-@LP 0S 80 141R00 0 0-P80L@T 0nJP0@@V 0-0SLPp` x@d^TP,P (0S @r$00$0@PV -L M0 KK@P 00S@vT p ٠Ki@ -LM@ KKP (00 Z KK 0-LMP KK@P 00 R, R@   R t !4!Q @ Ġ0T 400S 呠K0@@ -L M0 KK`@P(0sT@ 0(0,0S 9K Q-L`P <@寑@0PᮑD0P P0-L tX 0Pd0@0S P) 00DP<@q80 To( +0t]@VW -LDM@P Tc `^Q  @@@@Ah1  nX`P  8800Q@0 0p@!!(00K0 ,p$@ @@ @( 0!00'>P0K 00,(p$@ P@ @E(x0 00!h0,(p0$@@ @00 KE'(Kj`@VWt]0`V^pJ_vJ_W*_ -@QLp`< TF PP:*P00 /R0S /oHPPx Hx@ pi4PP00<(0$PrŐ@ȐD@ D$C@P?}J_V 0-PL@8jx0 ᭎PP ax0 -LM0` KPP   @ KTPKPP 0LPPp h P0XS    @00C@0$`V80080Vz@W@V -L Mp4a ,K3/@P(K4K⌠@P 04( (00 0d1R 0\@$K@Q@1@!0R *08 K*@P ( 4F@ ,(0Q$ 8@!Ԑ4! 0 g P N0 0! R!@Al80 000  0K03/@P 8 480( 0]@VDRSPWV -LM00 0z Kh@@ -L$MP0@K`4<0 @P0K8K@P @K(K080 (00 01R 0͟@,K  03/@P)q@P@KUZ>d@X1@!0R<*0< K@0 0P @+p @@KT 0 8ᑟ<P 0 4`P `$00$0V@80 P_l0@!0R:T@00pppG 0PP0   H0`0  0@P'6l0 p P4 fX00R0S 0 80S| 00Sy0 0kbV`00400C40 WT@% @@\ 04/H'@x(@v#@t @r0p@p@nmVL[P I0-L8M ,00@`'~!T1TQ 0L1$@ @ @000(`p$:0 ,00!1 01$@ @ @000(`p$0 ,00!0 00$@ @ @000(`p$ h@(d⇌\ℌ P <@88$Kk螈PoVJ_nVJ_mVJ_\J_J_J_tsV _ -<0ML0000 $0BP  KJ_ܹVJ_ P/P/ -@PL` 0 Q //P00 3/P# -@LP1 P40T aS 01?S0!t4 0003/PPatL1 0 1 000/5/ 000/!  000/9/%/ -1L@P`1 0 Q / 00 8P  0 0Kh/- 0-@Lg1<1ᕌⓌ⑌K0h p-LlM@` P1@01 ( d K?, +?0 00S 0403/3KjKp 0-LM@Q1K0hf$0S P 0S 1 < "90S 1 < 9\<H1US ?UK0hK0 -PL M 0@ 廈`PX  P`P/` PPXX )`(K+`0S 0UH0Q `010@410 01f7<h@41Yx0D1 PP[~003/`P 101aӇL@긂VtV -L$Map0K8K@ሁwPP!$.2 8@0 D@00  C3400 00(004K 0P 0"jPP 18 041(K400!*!0(08 14 W408 00 ] 0-@5L05 00$03/5PP0C8#85?o20S 0g -@L1 ,PU4PU  PU 1P 0003/ 1P0SL0L1101DPP!8004` 1 1PP   Q-LP@ 0 `j@DT0 0Kh/ -@PLp` = p`Kha 0-@0LP l K0h~= -0LPS`@  T 1 = <P -LM 0K#  K -`LMPk 2R 0S 0S  3/@_@ Tp 7 T T 0DS18T T T @T TY !r X $l 4Xo  $03/!@lT*@' T  T1TC $0CTC 0CT= 0TL1T7 0T4S44040@4@$K0T0CT0CT   T  T 13040 100 4KCz0(0 X0 ?#K<00,  @*@5 0 -QL< -L$M3@XpL0P@0  U "U U U U"@K`Vw@0XS1EXPPQn@U  UU~  U<U# U U  UZ Lc X ;#k _X $0 3/"`kvNVAL*`> U 7:E 0CSB <K`P0#KR0M4T2ZIL2 #08"@H0 L # 0P07H0L 8(XZ0@ @0 !@0U01 U `*VV 0S 0S  3/P` *P`>(K <K;`V8PU!` 1]#U< 1QR0011`@K,`V@Q`Ӿڸ0U U 0CU  \P0;07`P1;10S@0 5@000S@0 5@01`O6?B  -@LM,K 0,K,K@,KK -@LP@`(@0 0@S0S  0T 1 & P -0LP S@"@P 0SN0` ;00 -L M@0 Tؔ$Kh? 0-@D0LP#0S S c01@0@0H00  X @,X S00H0\0] ]0] -L@P`P `P H0101 $0\000' -LMP,K0 j빅@p `V !aj̅V 0K$03/d `VjV0@   @0 ,K000S00 0@K`5 80080@0<@0 H \ 0@0/ 800C80@01ᒆK0h101 0-@L䂆 K0h|  P-L2:@̀P`apVʀ 0! `! 0  , !|0 ,07d0 0!!`a0    !,LP\แ 0-LMPQ@K0h00S:\0<141@0)  <3P 00PH 0UDPD0<0RH0แ\ -RpLP 0(0h00S `V<08 SD @R 0C BS0Q `0@P P̷PP 0L00H@40B300\00T0X000 8V`0ST0S@L@T@P``J_ -PRLp/ 0`}P@P1  8P( V` ( @XPUPT0SPLPT@0SP@@@@@T@~`V7J_ -`RL@ 60 0S 0 S<8p\D@PPL0@\ 0RP0UP0SNT0S`L`T`PPK_ -`@PpLTXU] 00 0RX 0SUJ 01QT0S0T0@U; 0#! RQ&  3SHL0SP0\00<0CR1Q 07 00080 080@P@0P000p@L@$Kk}K_ 0-@LP L0T00 0-@QLP0T0S@0L@T@0Q 000000 K0hhQ/T RT 0 0SX -@QLPL`L0S  Q Q`0 R000S0T@@0Q 000000 Kh( -L@PTp``LWT V80 ~0@`0S0C00008 pB8pT 0S L@`L0SP0  RT0pGE-0`=%@L`0K_ 0-@L@0S08 0-LM@P1 < < 00D0K0 -0\`LP@ U[<S!p P  P 1S010SP0 R07T -4$LP 4`0?RH1S,@P (!<0R 0(1,11:11 011 `@P 1110111101 0 044T0T001014141<1<1@1@1D1D100 P 001111001.1010.000 0003/P V 101GB 0-LPL@U 0L0hPPPL0SP0T00 -L Mp0pP UY`0   M|@(K40 @P U U40 PP 0L00H@40B30\PTX0000  000P000 5 G5F]FK_ p-PLM K`@P   5Kp 0-P@L0S0ᬾ@g 0-X(PL X @@,\  0`S : -LȾ -0LP 0-0LS00@@K0h(ع -`LX0@0X0X(p@P @0S T C@#@X0( 0X0N -P@QL 0`S x舁 00S/I[# 0-@PLڽ0S0K0h] -LM@0p0P 0 (K`P ( 1:1Ջ`P ( K$. ៍=DC 0D@@ @ 0( 0 0(  ] 0BS-@LP`t`P  $0S0$S0ĕP`K_ p-L,M 0@S`  <KtPP Kp<0 <0 SP@ KDKPPP<04KV@ D 1;;14KPP< R (0 $R !8 tPP  8KtP< R $ sPP 4K巉 -LM0K0@ P00K -PLMp K`@P  4@ᒉK 0-LMP@EKePE/KK0 p-L M@` KPP  *PlKp -LM`P8 p冉P (0S W&@(K0K4K@P L000 W q 00 ~ 1} !* 4Sy DT 0S 4 P!z1 504,c @P!4DST 04  T10 414x3 40 ( C-     !8 **!@L|L xT 4W40000哼4610 4EψWv ,s00#. 010 44-@@#@@ @]`f_] -PLMp K`%@P$ : 1%@ @P% 0!00$@  0@1P pPt@ ဈK 1$ R 0@4 101 @ 0-LMP@EKAPE/KK0 -L4M`1P1R4a0pH0 0 0H0P08 K0@KL P2@08 K<K@80 @40 H0PL00P+<08000 PUY 4K:sP 0 <l4 @h (K0 <yz4 @st -`PpLXXPU 0 R  R@ @D@ @Y@P i -L M0 pRXP``(K@0T     R R @ 40 r`40l 4VPU@@HXU 00I` PiK_ -L|M   0X  a` RM R(PX}`p REp  K4 x D | t \I!P 1V@@T \` @12|0 0 0$ 00 K4Q05/ |0P0BPS 0+ pP  #P R7T9$lpK )qPP l0KW )`(K lpK || ^P TU @0R0X@ @PTP P0 R P _sK_[ -@LM`(KpOPP 0( 00009P† K 0-LM@K5PP JvPB嫆K0 p-L$MP@U  U00R0S`"8 K<K`P04KkU 4K<z<0`18  ) $ p`P 4KgtKp eb -50L MSP`@S|!0K!4q 0@PH 00,K00@PH, (K8K1:10 1:1ч@P9(0 쀟080(K4K 0 (  @P%40, ` `( (0000,10 S;305<0-@,T 4g 8c$Kw 8s,t0r] p-L M` KPn@P  19@ 00003/@ t݅Kp p-L M` KPP@P  e  00403/@ ZÅKp -LM`PpP C0 0   KoP KU P  0 S 0 5 @/ pPT 00   Kp`K_ 0-LM@K1d0000P0p `P 0#`P @ᛅP K -LIM @Pp  MKjo`PMK0$PK1e000 0`P 0#`P @mP Մ K -LMpP`P C0 0   K8oP K RU P  0LR 0  ;pPT 00   K0p`K_ 0-L@0M8K( 0$ 00 0 8  04 <0K0 K PP <0#P<P K0 -L0MP`p8K n@P&08 K43 0 (0S<0K@0K@P(0S@0 4K8@@P T 8K<B 8Ko@K< 8K@PsK_ -LlM PPp  lKnP\\K&KK 0&Kd T00X"d0 SH"K d `xKP@x0徤Z90 @ S;# 0 t 0St 2 LKknPt:40 P ?t <0x Sp0Kt0K0L0KP #0@?oT20StP &ZTx0@徤7 (K<0St0 HKLP LK0 LK00 CoP40@0S   p LK;P \K&KKP 0%KT0d 0CST0 P5k9K -PLMp@,K( K`P 0 0  K00, (0`a -L0M0(0 0$0 00K 0 00 00 0 000 0 ( K,0 0 K p-L,M@P`8K FlP3` 0 8 K0Kp -LLM` PTKP Kኂ`P0@ S;#\0 0LpK43X0 \0S 0@X0 X0T`(K儢  l0PX0pT 40 P0`0P ,0 00 m0P@sK_-/-/-/p@-P`U) 1S S0S0000 0 0\  P@00@0@ !<100@1 0pp蹁 -L M`ᠠV(K@0!R @T` Rp R R PPE%QRY040 0 8/0 40 4 0-@PL0S0K0hnR0 0S 0Q E,x] -L  -L -H0PL@`U0 P哵ᶴ{Kh蹁 0-@LP P PK0h7Z 0-@Lus-0 0-@L0T0  !R R R0500K0h/ R   R4r Q  1010K_ -L -LM@pSrP Nr`0` (KlP 41(Px00rrr r1r0S p$K%r` p-L M1PS`' S S#0S @,0! C0001,0 (00C  <-%0(00M  \ Kp$rK_K_ 0-@LPQ$P000-0 0-@L0 !R R0S P !0 -LM@0`SpPf@0P%Pb0@04p +0P`PR 00 X0 Q 0 a r CKC%PP PU KE`PNN0P @00@0(NK100 80K!000 K0K]PP N\ S m0 p0$ps`N@00@0(K P -Pp@L`V K>pp}NDp0S `V`` 0S t0S 0SLHv<KhW6%P KhZ蹁< 0-@L50 -1L@SP S S%Q㰳0S 0S PvXP0 @P0S@`嫳00 p/P `蹁K_ 0-@PL00帲80$S 08  @< K0h<蹁 0-@PL0Pᢲ 0  K0hݲ(0 S  00 0蹁 0-@PLሲ400C40ŲK0hd~ -!1LR0 0Q Q Q p)K_ -L@Pp`P 1S S0p -P@L` 0 @ 0Kh1M/ Q -L M⁀@PWpSc0S 0S7 3 upW23 p倣pW;l3000 ZA 00SX<3@pW (0S 00S 8 R4 S 0 0S # pQu<0880Xѱ>H & pXp 弱     A 0Q 0Q  4Q 8Q (QpW 1P Q @00ı± P S! Z}qY000 000 ,X 4䐟X  4<  .<0S00  0@000000凱ᅱMG!}8pW000 6K_<蹁<V -0LPS` @T 5@1 ~0 $0S  D 0-@LP30S 41x0D0nHn@0L0@000 -LLM`@@0pP%P&0@0 p @(p 0PP P T0DP @0 lP h o< lKi"PP p@00@0(KXpt0S&P"[PP塰p0Sް=P!Q ְ)P Lt0 ˰ t0 : !t0 P t0P R $岦$ '$ $ @ @ 4!x D :nH=n@ L @ @0 DD'@00@0PP U1S S `@0@ 0 $0S/ 0-LML@LPs $@P@ $0nP HnK0蹁K_VK_ -LM0 0 0pS`@UP/ P PK0S S SF10SB KaPP0S S S @0R00 @0R 0 0@0 @0R000S S Sl00S @ @0P D?P@  M*P*P` -L$Mp4 < 0H 0C# Pz 04a@0 ,U0 8 0@A80 0Sr 8 Q X00  D0 |PPD0% 00XU^|(PUt0S< iP @D@P T04 00. 8K} Z0 @D䐟 D H " 8  @H0 8 S  <, }8004  B4 m{D H0R8 @0T44 0  B&(KP(PP/ V -L \:`nP0PS00   4 4K0 KP`i@l@x3 0 S0#0380 00T3@@0 @0@b0p0(3@@0 @@0 b `tp26#p0P X(5"0"2i8 弒@ X  R2 0 00 @ZJ``d`VXbTH0$000<0!>@ ` @8@0 FL0,00p(00XT00C#"l  BS*8@T @( 0 #45 00P0 a?40 @ 00 0`?P0`` @TX 0!00R   \ ll3000 00" 0#)$t0PSx  $x x0t U Ҩ%+ 0-@0QLP ta@P 3UP000 0-L@"l`K0hl 0-@L  0tK0ha -@0Ldl05000  动00;0Ũ09    Q *  S0S;  0R9ڤ K S PdP 80 3/P0P =U0 %X%儨 0S 188@Q <   `d000`900000vl 0Sl0 CSl f x0pKhEal S0000@ ``0C p H -P`$@LLKh( 0-@Lߧ0  f<00 0F PU 0 0 0K0h/0 K0hlK0hM_ 0-L@PATK0h R01  0-L@]P 0P0<0! !@A(0EK0hK0h -`QL@Pt0UC QP $00媧KhQ0S Kh蜧 -@LT`T P$0S@0S@ß Kh 0-L@P7PK0h?P w8 , Q 0 3/0p$"000T0!x20x2R$4W0<0RK0h  -`L@V t0S`2rP 9S 8 ,0R `8PP00P0S1 (0@)0 0060) ѦϦ0 =0$ VT00T0U000 TU`P *(0!x20x2墦0 =0  -L *@PP P` Pl0U0Cl0 0x`` 0uY0 0$0 -`@4PLTl X0RP@ -@LM`pK` DQ\0 0QKK\ \       0p 0   0P?o20S0 R0dS 0*@lT0P@Pp`(K\0XRT  BRXTRX  ART|x -LMP`8 @ @Twc p$0$`W00 n  0哀"x`H4 4 WP ۥ_P 1!10R (K1  0R B!^i80S W 1 !0(0Y 0 ᓀ X @0媥lT0@D@Tl@%@l XR:T0R0B0@@\0AJB!2S8# &S0!S01S 40 tťh倥PT彥P 8@00  4/)M_+pl* 0-PLt\ @P 0:0L0 ( HD0Rt Ct @xx0剥0 0@0 -`0L@P0p0(   Q P! 50l0V0l0 bW` h il0P CSl ]@0 p>^V  UPh+ -LP`p) 0@P' 0 P p 8&@5P0 ? P9 Ѥt0Sx x x0t )  Y@P  0P |0E' t\txA'8dicx堤#!ݤP00 -pMLpp`P@P 0  0&U00000Qx0!t20t2t0S`oP U (`phKU h)`pi -LM pPP @ @@P0 ;`P D0@0K` -`L M`p 0P@ P P帀PE0VX PP"0 ;pP 0P 0(K P ;10 ^`p0/D0S @ R D00D0@ 0D0 R 0S  0 0 0T R P0ST T0P 0T0L R/H0SL L0H 0L0/WXⲣ X- L㧣0@-H1H!1,, N @0PD N @PD40 N @PE84 N @PE<8 N @PF@< N @PF@DD N @PG HH N @PG$LL N @PH(PP N @PH0W -0L@S04`00P $@0 `@ @00K4 K(KM_M_M_M_N_ -@PL0SPp`0S  ! PQPW\PQ 0L 0000 0C00S  ! PÁ -@LPTL`z∝ 04R00 0 nP00ā -@L`T N@0 SxPza0S0  Q    8   Q 0 @劝@ā 0-P$@L;00C0K0hvā -L Mp0@S`0L 000 QDQ SREP00!4 O,1 P R!z4 4     PR+73N`       0 0S0    00PA@(K0 S SR   Q 4 4 Áā -@`pPLUddM0`PP000S0  000$ 000 00PÁ -@L p`A00P1SZ R؀YXQ   000@ 0C0 00C 00 0C0 0P$Kk0 N_ -@0`SLP00Q0S0S0SP/0S5:/ P/ -LGM 0p41`QP8 0241 01 1 `V\4`77H<X01 V0$1 AT 0D1 /00D@W 10P p7U l7\7(K0 4!$]F@P0$1 吓L 0E/KFK@P t M7 V `0 @E7T X7 O<P@P +7PAHB<!71S C! /  C0Q1 00CUS0@@ӶW@ 0X K&F@P 7 T <1 D20 0A/KFK0 1  E@6 T 1!0! <@PX *KPOK  U0< 1 @ 0KK 1K 1 C?K0 00 K?K .K 1 ,! 0 %,!,0KK #0 GTP0  0KK @1S 0(P&K K/K   AR@ڸ^^Q Q OOK@UT A@DX"0#* ,1 ,1A  ,1 @,1@v B0P@t0S^ @Ł@^ -LM0 ,0  o K80 41P80o/Q / -L,M@ T8 < T"p,Ja@pP, KE"pE4`8 @ D :00T300@ p W0<0 E 80ORp:@(K -LMP40E40 0`p0E;@P 04 K0K<@GT t@(K40 C4 /  C07s4 K00p0A05 $1$!S pW   4zP44 4PE 00 Bā 0-@L0C,0$ R @@0{0ā 0-L@T/P00S@ S @R 00`00ā 0-LP<80@T$K0hL0S 3/@ā -PL`TpH0@T44 0S  3/PP@ā Q- L S &S KDP-/ -@@PL0S0 0S!0S00Q!I?` 00`00Q \R HH  W@W C0\S]N_LN_?N_lN_ 0-PL@@0S00?00P 0S(! // -x1 004,@($@@ @`|0 0@0@ @@@ PGDB 44X(KoS{"_āWN_N_N_0],HW^ 0-P$@Ld00Cd0K0h1ā -PL@x`V`803/0@Sh h0l 0lPd0@,Ph`@ā -`Lt˜dPUh0@ P Th0 Sl l l0h @03/`'@TPā p0-L➘d0\P@TLK0hט<0S d00d0Ϙ<03/ቘd00Cd0h@ā -L`iWTV@Pb TV @0V001S*0 eQ<@褻ā -LM<0 0P8 * ACKA80 S$ ^$؁cK X0``Va0 UT T08zLo \ aT0(K ^<0((0P#KSRYXH#KR0 0 UT) |00X 0S0 UT T 0࠳^ #KR00 00 |T 0\hV#KV0#K|X0\ #KV00 UTN_ p-LM$0PK@ `K0%`0 VPKp0 S 0S ([ - L[ 0-@PL,P04 80R8000804 (P[ 0-L@<  0K0hPā -aAUTL`pa(AUT(0V(0(P@PZ@ @Z!0,P00!R(0(0(@ -LM$0@`PV$pK0',K" K,0( (0 ,,!aWV!@PA ( ,0( ,0( (0 ,(`0 `P ,kFPRWSWHSWSWSW!R0 ,!(0(0 (`,!@PA -L$M`!PR@ RR' P p0` 0PR0V0&0 D0 R R R <P8  P^ 0V`p 8 P P P`0 0r  0 P@O D啖@0P R  !A 0!@0$0!`  (`,`0   R Rt RP 8K(P0#P@D奖T 8P (K@ 0@ P0P0  PU00P0(`4000D8000@4000uZ(0PS 48 Q8 0 804 0(0U7 ꔐ " ZРZ R Y VS Q(0 @ # P0!4!Uu P S 0S 70X(`PP@0p40 00K0 40K0P 00C(pS XWXWYWYWYWUl 4 @0 ( Pf0S0S& 00 4 0R a!WV 40@0!(@PA0 8 K,0S"0S40U0 @00( ( 0 ( 040 P48P808 4(@4`0 8 0 040000 ,0S(p(@!R(040 U40@000(0!@PAP a!a`p؁`YX`p a X0`p`P@P   x  P Pā 0-@X0ML0L0 0D00@0@@@L$PK0QWQWN_ā 0- L:D0@ N0PP00 :@0ā -LM<0 3`p刑00 @8 ,K) >PPp UaL0 `0(  Pt0[0(i580@P4 0S #P P0 `000< 0(KS& A PF5Ux`R낯0 tS&0 0 :0080@0/5008 0< 0L0 0 `0 P%0 0580@Pu0 7SP PU<0PP R 000C00  C 00 0P 00S09000S<00t RppW   P 0/ P0  hA040p  4W 0/PqT TA0/ xZ T \4T 0t0S/80 @7A404ŁN_ 0-0L@00 P r/0P0K0hk/ X0-PL  P  P 0P $$R@P@]5O_ H0R  R/R20R/20 0-@$0L L K0hZ9ā 0-@L P9 @  0 0-LP@P 0+vOP 0#0 -LP`w@P P 0+tOPP@  Q0-L@K0hP 004 0- L@R(0nL0000ā 0-@LP@DT@00 L@0ā -LM0 0P0 0 0 00 0 0000p0 0x0 p0np0p 0P0 $0 R t/ R  00.0 .0000@T t0S |.0p 00>a0 P l.0P g.000418 r`V 0 |>`0A0 /RG @ T0@ 0 T ` 0 d.0 P _.0P Z.0000S =a P 0S" 041 `$1`X 0  0 \P 0  !"@@Xx t 3x0h@ 00 00x00S00x0x 0< 0p00 0x0 0 /R) Rd@ h k h`@T*-p0@@00S 0 0 00000000000 7x 0 0p0p 00C00 ` @A /TT@@TpH^G @/P@ /P B @ R R )  Q .P.Q* * hd0Kh KP hP f-0p 00000[-p0?@@000td0S0  t0SJ0$*0 p0 00p 0 0 0Cp  0h00 0S 0S  00 00 9a0$0 S$ 0`0(05I J` ` Kp;L  KLK\0 8 <0 H 0LK />P' JSx00 p0x h 0 00S,d0h0 0d0 0 ;P hP ,d,T< ;rt0  J0SD80S 41 0 NJ0/`| 0  @@R0 {R@}` /Vt  0R t  0R0S LP0 Si*0 |0/V  @ @0/`0 0E00/V0  t0S (*P0 SG*0 |0/V   n@0/`0 0"S00S /Vt0 S P 0 S!*/V  @|0tJ00 /` t R R  |t0 :6 |I0 t00 Sj:5 I?Kt0 S 0S /Vt0 S P0$1 0 S */V0 t0 S 0S /V t0 S 0P$5 0 S*|0/V  4 @00t0 S 0S /Vt0Z PNO9N0$ XKN0 S 0 */V XKkt0Rt 00Ǘ0 0 t0 0 3 lI0 0 0O=000/S +00S0 00 .R  .R0/S0 0 00 +800 0 /RR 0dh0 w+0d0 x0 00Sh h0 d x0x 090d0S p  ShP SYZ+0h0 dd+p0 d w+tdn0x00SJ hP d `` QB x  >P J+dH+0p d0 00000x00Sn :SYM 0 00 00C0>ECAx00# hP +d+0p 000005P ++ d Q 0CShP P +0h0 d*0p 00000*x00<x00hP d0P*0h0 h0p 0d000S 0 (K*`X$ (Ł[_O_@ā _dO_ _iO_ _d\h\]^ _`[d[~O_O_t _,^pO_+^m _,^}O_^O_O_t0 S p 0S9 /V jt0 S l:PgxO0 S T*/V 0 |0 @|TX t0 S h 0SQ /V bt0 S P_'0 S ,*(/V 0 |0 @TL P t0 Sb 0SI /V\t0 S PY0 S 0 *0/V|0 @+EI* 0SH /Vt0 S, PM{L04" XKL0 S */V0 XKt0 St0 S 0S /Vt0 S  PnM_L 0S /Vt0Y P ZMILt0 St0 S 0S @ |}V0 {  0:@ 0|  -LM(0(0 0 [, $0   K 0 0   ,K@,K)K -(0LM(0 0$0 0 0 0[, 00K00 00,K @,K K p-L$M0@PIP?P^/nPPPX`=(000 0[P0 0K04P,P (P 4@ $P ,0 ,0 ( < 4 PX0L wF`d0$0d0`P Pā0Nā 0 Nā0 Nā 0-LMt0@S@UPP@p0K!t8U@P@UP@%K0 0-LM@P 0 TP $t0S# Sp0a@P 30 QP 0K P ,`%V UPKp0P ` @  @0S/# -L`/000@

T C AQP*WV$s@WV -LMCpPt @P P6 P-T3 0QP<G(3 SR$ " "|GB P 3@P F$KF@@2PP tPP[ D0SO@ 3/@d00Cd0Tq P(R n3x$ b PU D0S< d0 0d0>D03/@ d0T0Cd0-I/U0S#&X fFt݈|Q@T\h\FXWFP0@ OF,MFO@hPh0CFh@,`G$,5@`, 080 080;$080@"l(K(@((0 P9(0d00d0,@P dFĀP_'dP_&P_GP_P_P_p'^ā Q_$Q_WQ_^.^oQ_Q_GāQ_ -LP.p@P4P p `cp000@@Kh蛈ā -L\M0@0x p`0 HP D (Kt0S <0  51PP, E @3n`0(0 0 O(0PM8(0tK nPT t0@ D h0 l F< lKt2ZXP u#7P )Fp R h#0"P X[# 0,00,0c(0ASpPXH#0SP pKp Pq110SZ ` R8X TM 0|0 +0Tp5#p000Tp,#p00 rZ "Y "勇ʇZp,0T"p#p0,0p"ẇ$o8P " x0 #T0 w p 嘇Q_>Q_>ā -lPL` F@T  R00 < }Kh, 0S0S @āā -L MpP3 ,`(0N @, 00 (P @ (   ( &  J`P)H, W ,  i @T ' p 4 R. $E 5`P (K" ,`P ,  , ( A X( @PP(PW 600 ( P$$( T %"Q_ 0-LMd0P@P  {P 0N.0,0 $FK0āR_R_ -`LMQp0P"Ḡ#KK@P > C#K N P 0N.0 0 lRF`8 U8 p @CpU ,C C(Kā0^R_,R_PR_aR_ 0-L@C K0hR_ 0-,0LA00S0K0hpd0P0S R / R 0S 0S/00ā 0-LM  $K$0 U K 0-LM  $K$0  I K 0-LM  $K$0  = K 0-LM  $K$0  1 K 0-LM  $K$0  % K 0-LM  $K$0  K 0-LM  $K$0  K 0-LM  $K$0  K 0-LM  $K$0   K -L M0 0  $K0 0$  0  K 0-LM  $K$0   K 0-LM  $K$0  K 0-LM  $K$0   K 0-LM  $K$0  K 0-H0  9L@PH0 0S010L0AR AX00000@@@0Ł -@LbM K|Kxq0Z `[K0$ P0` ? K[/K.K(Bx0tp$S K! !QKt `B\0 0X0BT00$ #B0| B R`0 1 000tB`P`0FS\lB 4PhBKcB`]]4^S_R_md^ 4^R_R_S_HS_[S_R_.^rS_ "0-DML00 (00!1@00p`0< 040K0p,`$@ @@ @e 0'Q!14K P000K,p(`$@@ @O0 0 0!014K 000K,p(`$@@ @<0 0 0!04K 000K,p(`$@@ @) 0!0P4 K000K,p(`$@ P@ @)0 T @H(K0@0Ł^^S_S_S_Ł -LMphaP`@1` 0,2`P&W  %l@Th@T#^ /P `0 |0P s 00 F00`(K^ @0 |0P03 0<300+-B @   -LM#K`0`000p C4 c00(!@P0! 0 00  01PP峃܀l@Th@T)KR0|0 aP z tڃ P(K @)KR0| 0 GP @  0-P@LPt00CS 0p0!Ñ"h0|0Sh0|  0h@0000 -LM 0 0No K -@4 <P$p?L`McKv$zfT(Kp0 ß#K 000K0 0 MP j@p0.0 -P`$@LKhKŁ 0-@XPLH0  9H00 S0 1 0 K0h/ŁŁ 0-0| L@RP R| |00S H0  l R;H00000K0hd!Cel -1| LPR@ R| |000h`S H0  l R;H00|0S0|  P`H0l` t0TpS S MP  `0S (0@g!Ce 0-0@ L R  R / R     , +, )R QZ0Ł,0;,0/ -L,M0@Sp`0Q`-` 81PU Wg@@hP 0 LKP0 ,P0VL0K LK KK0LK-0KO`V`pS@(KdP dH LK9` d V Bd P0p@Hā -QLMp`-P 0SP R  P010W>00$K@KPP@D@K P ꌐY $@D Pv@ K KS9PP KM9PP  ^ @Y 0-@L0 0 0000p0`0P0@0x0|00 -LM`Kp@0$@0 K0cK KШŁ -LM`Kp@0$@0 K0cKKШŁP 0/`]R_ 0-@PL ,>|0S0>K0h.b^ 4^ -LM00FPI@` 0@ /pl@TLY 0|  2?30090 R0 P $K@@,T0Sl@T JDT_S_ -`L MpP"BVB I@B@ 0 P'C0 (KoB 0-LPH婀D0@T00nPh@d00d0ā 80P0-L@P0 p0x000800)%*&(%)& +NK+ 0|00 -`L4M@8 P @0 VZ 41U!81 0< Sj q H9?, K00"0 3P H D0 庯D00<0H 0 X W9(K008H UP1!D H B9 D0S)40K H<pd0Y 0SV, (  ( ( M8(0,0A ,;*S fzYT`0d:V 0 P 7(04(00S MR\0SF XCS 00@ 0X PK PP3\ PpP-PP` V 0 P ,Z7(00P]]^}U_U_ -LM 0 0 0000 s K -LTMphK @P 080 h0<@ d@ `0 84 dKL@P h KP`h`P&@@0 4:@P (0 L0@ E@T0S Q -LMp K; r@P SK^PRy(` @0(0"@(0@0(0y -L -L\M3Pt K@P t0``0 SDWWWWHWWWWWTWtWWWPW, dKPdK@P,  t| K 0dKd K@P dK0@$ 0dKd K@P$ ( 0dK pKx/@Pd KpK@P(  pKpi/@P( dKc/@Pd KpK dKX/@PdK@ dKPdK@P@ @ dKB/@PdKp@ dKP6/@P dK@P@ 0000rp@ dKP/@Pvp KdK@Pp pK*0P@ dK /@PddKxp @m1+P.@P 1M @W@AP]ā -LM@ ,K.P,KK -L$MP4!Sp88! 8w@P00Sp!8@TQ \ 1?,@K00$0 3`8 <0 吧<00<0 0@8ݧT  ,1(K0080 ,P 80崐  P00/S S 0S@ +T ᗿ+ ᑿ@ 1(0o80 āŁbO_ -LMPT0`p K@P 0 0 0`m@ KP] -`PLH9 0@`P @/`+ -PLM Kp`XD@P  04 00!0`5@CK -`PLH 0@`P /` -LM41Pl@80 `s@p0K0TPY8080P 00 0`0P0U'@T00U0S 0 p@0!UT*0 0 0P0 3/0P0`PP@0 3/0P 080 80(KbO_ -LM0 000 Kh@ -L M40K CPP.00@aXt0Sp"V*  ' S)0  S00 00 Ā $K0TS )S S0K KK K9 @P K$ 0K KK@P -LM@# Kh\@SK -LM c K -LM!  K0 c8 c;9 p-LLM`0  1 1 d0K@P+`Ks@P$0P00 `0\@ 4P X0 0\K, @PH0DS@dt0S ` `0R@4 K@D D\ `dX Kp@4KDH0PM HPV P]X] -;ML 000c0  K -LM 0;0 00 K0 c 0c0 0-LHM0XK@P$P0T@ ,P (0 X0P0 0$ TKE@P X@0<S(0,KD<@0P  @P X@K0  ,K@@P ,K<+< 0 c/0,0 c' -LMP >pP 7 (0S>`t0S: 0S S S, @P @@PR 0  P0  0 KP 9= (K@*K/ -LM`p=PP 0= @(0St0S !"K  @P ,0K0 ?L@ K@g= 0-LM0KA@c LK0 -LM`pw=PP 0H= @(0St0S !"K  @P ,0K0 M@ K@(= 0-LM0KA@c gMK0 -pLHM0P@' hKT``@Ph08` <@ `0 d@ e/4 0 ` G.R.H.S.dK 4` ]@P h0$KhPW@ PPP @P @ -0ML0 c K -LM 00 K p-LLM``KP@P`0P4@ \@ X0 0P /\K, @P `DKpH8@H -LM0 c K 0-LM@K@ P@0cP 'K0 0-LM@K@ P0cP 'K0 0-LM 0PKP @00@P o'K0 p-LLMP`K`@P T000 `04@ \@ X0 ., \KX@P `Kp H9@H -LM 00 c K -LM 00 K p-L MP@0` KK@P  @  KpP] -LM@p K:<PP  0 `Pu;K p-L MP@0` K@P  @  KpX] p-L MP0` D0D0 0K@P  @  KpX]P] -0ML0 c K p-L M@` K;PP 0 P;Kp -LM 00 K p-L MP@0` K@P  |@ N KpX] p-LMP0` L0L0 0Kv@P@0  w@ 0 KpX]P] -0ML000 c K p-LM@H0` KvPP0 00OP  KpP] p-LM@` Kc;PP P07P ;Kp -LM00 00 K p-LM@` K@;PP 0 00P:Kp p-LMPD0` K!@P@0 @  KpX] p-LM@H0` KPP0 00P  KpX] -LM@S11\Pp `@KK0s(0sK0Sp"0K Pp (K 0S  $PK0sKj"KiP`  K&KQP%`\0V``K80 sK0 s KVKdKY40"K040 ZW  P0``P]X] p-LMP` Kp:@P 0 @0@0 ce@:Kp -LM 0  0@0 Q K -LM0 cC K -LHM@PP`p 0S <K#P<K 1ST %K? T  1SD !$K? D \K0 0K - ML00 @0 K p-LMP` K9@P 0 @0 0@9Kp -0ML0  K p-LM R0`P@"0 K@Px} t0S@ @P"]@PKN K)K"@SKpP] p-LM R0`@#K9@P0 @ PhG t0S@ s @P K )K0K P@-9Kp p-LM` Kn9PP 0L@ 0 0 ?P 9Kp -L$MP(KM9@P0( 0 @) 00  0 a@@@L0 0R`p@ 0H#K #K` (0 @b8 K p-LM` K9PP 0L@ 0 0 PA8Kp -0MLc 0003 K -0ML00( K -0MLc 0 K -LM c 0 K0c00 c0+c -LMPp$K`8@P$ 0 @ 0K @@0 0p0@0@0S 0  00;8K[ -p`41L8@ P%100:#:1x p-P`LMp  K@T`)0 S0,@PKp 0-LM0<P K:@P@K0P] -LM`Ё 0PJ 1 R0R 000(K0K 8P00  ` @D t0S`  0`H 7` -LM`Ё 0&J@Q T0R 00K 7@P00  @ PP t0S@  0@ 7(K@0S , !P CoQ// -PXaL1BTJDqj@T 0SE101201B kT,]@j, 100@S$ $0( (@j1201Bj0P0   PU 0STjU  000 @0S @$@,Ł0Ł4Ł@012SQ  R R0/0 -LPxnjp@ 0S0\@ 0,`0S Q R$0- -,Ł8ŁHŁ 0-P`@LFj00CS0 K0hj(00C(0zjK0h,Ł -LP0@S00 `#,p$P 0 P05,1,X H j@pP 0 P0Djs-,Ł8Ł 00-$@L0+ @.K0h-j,Ł 0-\@L ,i i i( I- F-i+000,Ł0V_7V_ -`PBLTB0S opPP PPP@ -LpEP0@4`0PP P PpPi@i4Ł -H@LP`pi0000(00(0iKh6,Ł00S/ LŁ00S D/Ł00S/ :Ł -81L0S0PS0C01p(0SV+0S4 o+Mi00,$Kki`1?@T  R   R  R R R  0S  B  1?00$Kk7+Ł,ŁHŁ -L001@o -L Mpv@XP5 `ܐhp* P!UX10WPP0T 0S 0S 0 0P0  $PD00  -PP00 X0 00- i(K,Ł8Ł -L00 0-h0LP0S-@ "U@@ 6iP#@hu@P h0ŁXŁ -Le KhhXŁ -@Lp`ph@\000hPp ` 0 0S 0P0 P0n4Ł -PL`p @T ^T0S0 R @S    -0L` P;0@t0S`d3P (10S00PS00* 0S( 5*h@ 0S00Mh pW@0;00S0C0* 0S *pg0h0x+X4hPc+00 *0  3/@Pp0)Ł,ŁHŁ8Ł -@`LPg0S@00@0  Q  ) U0P00@0` 000C@0@0@@@08PE_oRSPU @+KhgX@Y 0-@L,P0SS0 + --L M U% 0-P@LT  D&T0@00P t R2`// 0-@Lgnt00CS2ږQ,*  0K0h \Ł 0-0L G @ I⻖0 L,D*000 t00$#00Q0\Ł]Q_Y 0-P`0L0T0@1AT0 0R 0RP @\ŁX P0-L@ P gT BpP P @0 <0Q4 R/000 -LTM2@a00H0`p Ā aH0wfL0\P0L07*f(K0**@Z]>V_X\ŁŁŁ 0-LM2d @0PR0S u|P Ff;0S X0S !d1!1 S00 ,f|1xoPeUQPP 0SP0\ S5R3XK000fKPa0[Se0,0*0[S!PH0  xalH0@<b&pP6e80@0400000\b8KP*D1@!00A$b0< K (p@  07/pP b0@!0`1S01 R (KT 0z,0 L00L0@db<00`b0,0&,&bbX@Z\ŁZ -`0LM P0pP P   0` ,` @ 0 6/pP .b(K0S 0`bР P&00 `@0! APb,0 L00L0W`ba0X0K&,I&88b6b0@a /b. a@Z\ŁXZ -LM@< <K8 40 0,0 00K0@ (0 P00p@0,00(00 a0K`P : KL00<KP@1! A<00800400 aX\Ł -LM@< <K8 40 0p,0 00K0@ (0 P a<Kg@0Kc`aa00W0,00(000 @!pQ ^A @P1 S! Q  K0X\Ł p-L M@[P a Ha1@!1S01 R P00000taP 0K   Pt x0a\00d0L0 00L0Qa`tKpX\ŁŁ@Z]V_>V_Ɓ -0LST  BRT  Z, Kh;%]V_ 0-L@?0S S00 -@AL M88Q` pE `X QpE 0V %6$%0$P``@0S#*0P  00K `@q0`000@0 X*l` ?(K00010QPU`\ŁXYhŁ@Z -LMP`@ p_0  K -0LSt0S  c\Q 04@SR 4@Q`4姙``> H / 0-Lt@0 0\0:0\0<\00 \ P00 K0h 00O00 0-H0L@ 0 `H0  ,aU RH01X1X1X1X1X1X1X90000000 0#K")K'0K@t0KPd0K`T0K00 0@0000404;$x0| Kp9:: :9: P 0-L@Pk 0@?o280K0ha -LM@ptPL\UPP0 \-K R00(K-K 0 KR0T0p0\2 QP 0 P0000P\PPPP\ 0` 0`  1ሡ"K % 0S!P0` 0 `0(0t0S2 011" 0PyZp H;(#L0妀10#00 _L0X0L0 ^H0;H0 _ 0p0`0Pp0Y K!-K K  JZ00P0SpP[  0 ]& 0-P@L$#P 0 -LMPpt R`d02@@^ 1Q|cK  @ T 00C#  K410S@$1Q  R>@ @0Q  R20K@0@?| @0000S@ @)0 S 0@PVp`-^`014120 @ Pf^T @@f@zfzfat > -Ppt,0`0QL@ 0@L`0S% (0" MKJ{   }P 0 0  Z   L0J  -Pp ,@0@L`0 MKJL`?   0 h0@ 0H   -p2LM0@P = P2|1b,048<0,05  L0 0,0 ,0( 4/ P #  PW, PQ Y{(AK00 0W 0 40040 0KsP  (K (p0D0,04[ t0S? 0t0S=  "  )  }pP  .]X00X0k] 0P0W0\  pP Kx 0K*K  pPp-pOp  -PLP@`| \X00CX0*] DP[  -L,M`pP@PTT0KL0 0H0 $K 0T P@ S<@ 8 LK LKJ@PX0 LKi<0Y@000P0S@W (K041D040 i -LK0 0G/Kp0$0@$000c-TV0K0T] -LFMPp`0 GK@P 0I/K@PGK0 0>K0 0G/Kp0$0@$v000c-TV0K0\] -LFM@p`0 GKPP IK$PP$1GKPq0 0>K0 0G/K0p0hP_$000c-UV0K0 -LFMP`p0 GK@P\0.K@PGK@ 00G/K0 @ -TV@KT] -LFMP`p0 GKz@P\0.Ka@PGK 00G/K0 e@ -TV@K\] -LFMP`p0 GKR@PK@$@P 1GK@ 00G/K0=@#-TV@K -L$M`0p0 K@P(`,0K00 0@PU,0PV,0 `F(0K000zP P@( ,0( 000-TV@ KT] -L$M`0p0 K@P(`,0K00 0Q@PU,0PV,0 `F(0K000?P P@( ,0( 000R-TV@ K\] -L$Mp8K#@P*`80 40K00 @PU40PV40 `F00K0 0P P@0 400 002#-TV@(K p-LCMP`0 GK|@PP0.Kc@P GK0G/K @ -TV@KpT] p-LCMP`0 GKX@PP0.K?@P GK0G/K @ -TV@Kp\] p-LCMP`0 GK4@PK"#@P  1GK@0G/Ki@"-TV@Kp -`L0L@#2000FSP`VP`0P V`00 0-T0LM% K 0  0$KP @Pd0 K03/@$K0<] -H0LM$0   0) K(K@ Pd0$K03/KX] -LH$M   0 - K0,K@( $ Pd0(K 03/Kt] -LH$M   0 - K0,K@( $ Pd0(K03/K] -H0LM$0   0) K(K@ lPd0$K03/K] -H0LM$0   0) K(K@ UPd0$K03/K] -H0LM$0   0) K(K@ >Pd0$K03/K] -H0LM$0   0) K(K@ 'Pd0$K 03/K] -H0LM$0   0) K(K@ Pd0$K$03/K] -LH$M   0 - K0,K@( $ Pd0(K(03/K8] -LH$M   0 - K0,K@( $ Pd0(K,03/KT] -LL$M, "K 0K!K01 K@( Pd0,K003/Kp] -LL$M, "K 0K!K01 K@( Pd0,K403/K] -L$M0 0D$ 0 1 K00K@, ( Pd0,K803/K] -L$M0 0D$ 0 1 K00K@, ( |Pd0,K<03/K] 0-T0LM% K 0  0$KP f@Pd0 K@03/@$/K0] 0-T0LM% K 0  0$KP L@Pd0 KD03/@$K0] -D0LM% K 0  0$K@ 2Pd0 KH03/K] 0-X0LM$0   0) K(KP @Pd0$KL03/@(K04] -X0L,M40 , ( 8K "K !K09 K@0 Pd04KP03/KP] 0-L(M\"K "K 04 9 K0 8K0P0 @Pd04KT03/@8K0l] -H0LM$0   0) K(K@ Pd0$KX03/K] -H0LM$0   0) K(K@ Pd0$K\03/K] 0-L(M 0 0\( 0 0$ 4K0 5 K0P0 , @Pd00K`03/@4]K0] -LH$M   0 - K0,K@( $ xPd0(Kd03/K] -H0LM$0   0) K(K@ aPd0$Kh03/K] -L$M0 0D$ 0 1 K00K@, ( GPd0,Kl03/K] -L,M 0 0L( 0 0$ 4K0 5 K0@0 , +Pd00Kp03/K0] -H0LM$0   0) K(K@ Pd0$Kt03/KL] 0-T0LM% K 0  0$KP @Pd0 Kx03/@$K0h] -D0LM% K 0  0$K@ Pd0 K|03/K] -@0LM! K0 K0@ Pd0K03/K] 0-`0LM% K 0  00$KP @Pd0 K03/@P $K0] 0-P0LM! K0 K0P @Pd0K03/@ fK0] 0-L(M"K0\9 K$0 04 8K 0 0P0 00 }@Pd04K03/@8FK0] -D0LM% K 0  0$K@ cPd0 K03/K] 0-P0LM! K0 K0P N@Pd0K03/@ K0,] -@0LM! K0 K0@ 5Pd0K03/KH] -H0LM$0   0) K(K@ Pd0$K03/Kd] -L$M0 0D$ 0 1 K00K@, ( Pd0,K03/K] -H0LM$0   0) K(K@ Pd0$K03/K] -L4M#K0dA K,0 0< @K(0 0@$0 08 0 00 00 0Pd0<K03/K] -L,ML"K "K 04 9 K0 8K0@0 Pd04K03/K] -H0LM$0   0) K(K@ Pd0$K03/K] -L,M 0 0L( 0 0$ 4K0 5 K0@0 , ~Pd00K03/K ] -L,M 0 0L( 0 0$ 4K0 5 K0@0 , bPd00K03/K(] -D0LM% K 0  0$K@ LPd0 K03/KD] -LH$M   0 - K0,K@( $ 4Pd0(K03/K`] -L$M0 0D$ 0 1 K00K@, ( Pd0,K03/K|] -L~QY_ -P@`xP0Lt0@00d0L00L0 0( 0P0PƁ 0 //0L0// //0/ -L -L 0-@LkiP 0P nP \0 0-@0L$ @ H0 -LdmY_ -0LQ -$0L@0 Q/ // 0 //0@-0S  0S@@0S  000C SHmXtmXtmXtmXtmX\mXhmXtmXtmXhmX 0( / 0, 0 / 0-@PLP0S0K0h P -0LP R R  p @` `H 0P@0  00X0T`;T5 300. R(Q$ BAR P  $Rpp00W0S 0\<000V pp=W AP tPP1 PU(0<101TP P 0-P@LTDM0K0hM!0Bs3@ 03@+ 0-| L@000H0 0nH0+ R;H00 0-0L@0 tMsMK0h -LtM(K P 000 0S|00 < K $1/cKKt0 S `0 @0@4V0pR``0S>MT00T0{Ml0H $` 00` 00000S0H000H  03!30R0 0 7R0#00S00H 0(K%K0L0 Y  TP T1 0d3Q\0 Q2Q\0 UP0S4X0 D0K040K0@0K0%K$ P9 L0 0L0 LHk0S- HݢB 夒`aR堂Vʀ 0! `! 0    !H03/ 0!!`a0    !(KD%K 0` D4h0 0h  d3h0 0h 63h0 4l0 0Kp%KP 0Y0K 0&Kd0p#KSR0S 0 CT0 L 0L0 d%KI 0%Kk%KKSR00d Y00SH ᜣT  Bd0H娢 0X\) D" 0d03p0 4t0 K%K R02ʠ j Z| SQS:| Ux0 K#K 0@#+,LP -LEM0 $`00 @0  000 `0Y  000 /@0PP0 :90 00 00P 0 Q #'K 0؀0p|00 d K 'K1/ '  ?KR'K|\K1/006%KP00SLP_0SL(K |00 \ K 'K t `0R(03 RS|00 0S 3/0SI 0Q 0 ,0KD #  0 0 =PP  `P-0p0 p0Sʄ0 01SP000U0S 0S 1S 0 8 03/10Cs` Kt0S 0`0p 00à%K)K R 0K0#&0:0 0C60 *KW0 Kl 0L1 p0 ?(K  0)K0 ?  0K 0 0, K K0,0 (K K0p,0 KP 0 KR vz1 S 1 P P!LKLK0S`00 nJ ,K0S0  0Q/8 03/P01 0S0S - J#KR0 0S- L0KZ  W 0?o20 )K X0":0 10 0 000p0K0 0H1P+<1 0pQ7B0S p0 0p0 PX J1 `p0SW8 J0S J0P} 0!P 0S JPL0KZ  !#@P 01S 0S p0  Sʮ)KYX00!pp WppW  ! 7p ,0K( #  )Kp0P 0S p \JfKp0 0 t0S `0 0400 P812 1 0S  0P1  060 )K V0pR0``p0 R`#0 01P00000w$`S6007 0007`` 00000C0 0S{)K'K01 0 0S 'K K R0"f:0 013@x |x Y1 0i3Q0 Q2Q0 Ux0S90 l0K0T0K0h0K0*K0P0 w 0 00 0S 0S ኟ 1 R00S 0S00  |0  1 000? )K1/0P0 oI0 R0Iἠ0S 0 P \I0S p IP%61`jf3@ 1 M0P0C0 o10K1 0  S:#  K0R0 l00 l*K 0` I90 0  i30 0 GK630 90 0  'K KPG?K R0`G?K ñ` 0GK 'K 0KK 'K 00 KKR00P0?'K 0GK %KSR_G?K0p#0d#0 `p'KH0 V &:1 1C|0 ſ000 H0a1 S$H01 00C0 G?K 'K0  P!#@Ơ'K \0G?K R0G?KñP R # # R # #  )KKSR00 R00S  ᢟ|  0 Bᮞ 0) I 0i"030 90 K'K R02̠ a P SQ US10 K%K 0h#!0R00 qW !3/o"## @03$#0U0V0S 3 3@ 3  P~3C030S00 PPY_+LO -L_MUK 0P01 t<1D1 h@vM?KO?K P0'|KT  @"KK UKR0࠳K?Kࠣ R0Q0 P" @L K?KK?KЀZPLT 0 0L1 *0KK R0K?K @K?K1X尃 04 D10S0 @1@  0S@M?KOK R0N+D1X!S M?KO?K P0 K@   K \ F띐 SFM?KOK R0@0T0 00@# 0 #%ʎ0x1 !p1S 1!P03#10#0 S# @ CK(3E/K03|00 G/K K?K 1/)0KKR00$ PG?K R  0KKP0 30CK0>K0K?K *R0$  !R $A!᷻ !$10CR  ڼ ,0K 1@E?KlЀ 0$  K?K  X0 R0SK L1H#*PH6 $! 00,0K LI?K0K?K *0M 1 $10$1 0L1 @1 01  `E0?p1S \1L!` t1|!0S3Sx1\1 Vj \ Q0p A $1 q l!C?K1M/KO/KЀP  R@ԀP  UKЀP  R@!I #RFl10l1 l!$1Sʄ1S 0EM?KOKW V R0  ,0K #R0 00 K 0 }E|0$!CK0@18/ 0EM?KOK R0N@0hq T0 00X@w h0d S  d 0x!R 1 1#  #XD!Rc1 d! D1X!S 101R0d1S@dAdq BT0S,@ T0S S DXhq !$10C6K/K0 6+Y_Y_+l* -0ML 000!  K 0  / -LM@0Pb ,0F00 0 0' KLO -LM@0Pb z,0F00 0 0 KLO -LTM0$@P0  @ph K` S0 0 0`0 01S@@Th00S (K0K6#P0D@@{D1 12l0 ,0K, #&KkD XX0S@X DDXQ1T uRDTh00S s13@ K6 T T K@L  KLKH 8@ P < & l0LK@P< R TT 3@ 03Pp+ -L,MP01 r0,`(@VT0KT LKL0 @` PP H D@ 8 0Pd0PPEl000 L10|0 @1 <1!&Y3:|@1p0h0 000P0:#:00$K+|+0  PlYK00000C0 0 00C0d04 Kg0x 4F[Y_pغl*yX 0-@LPVB0S K0hB SS-L`Pp@ ZXT W PKhJ -LMpYPp`40K0@ 0 4/@P 0T00S4 +h40Ww Sw 4P$03/@P!p0Sg00K0 0 8/PP 0U00S0@ @ t0SXp40p0S@ 4P t0S4P A00V1 W5 4P t0S R0P 40P J0t0S p0S P4P t0S P04  $00  (K40P P0P PP@ @@{ -LM `@ 0 WT  W 0 000 0"? 0" -QL@PP @Q@ 090 0>#D R0p`b0@@>D# R0p`0b@@ Q0-L@ @Q<  0@9 0$0@0$00PP>$@>0$0$$@E/!R0//0S-/ -LZ_// -PL0S 00s  r @pl 0 r 0 `V S S V  @ Tp- // -L* 0-0L@ @ DnP@@0m -Lm 0-0L@ *nP@@0m -Lm 0-@L@nPzn00//// -0L > 0-P|@LPmP0|Om@-`0@_`Tap ? 0-@LP0S :S 080H0PP=00@=0 00]]]|m|m|m|mm|*n -LMpP`@]P @00<00 K KaPMP0 @ Q S00R 0T0R0T0 -L MpP`@'PW  O   ( K0P(0S K -L M@p`PTP@@  KUP $ K@" P(o -LPp`@P   Khy -L`P@PPDP -L`P@P P -L`P@0 ᇂP  Kh@Ip^// 0-LMP  0K K@P "00K0P/ 0-L@M0K #0,(<@P$  A JK0Z_/ 0-0LP@T@0@0弼 -L`P@峼pP000000 0 0!!!!""""####$$$$|0|0嵻/ -LMp@ K ᪳ P` =4 0x0t0t0 0CSd p0!p|` 0@Pp0`K p-LM` K@$1/PP 00Kp  4PP ~PP [ p-L M`@ K⭼PP 00Kp  PP N[PP 8|0哼-/0T0/0X0/ -LLMP@ 00 0L `pd00  \\/`LKlK 01s  V! > R dP9 01`VɐL0 0`d0lK13/L0K  r P   p0 p0` VɐP00X0S  P 0 0 (K!|  p p]^ - L@0` `0(0 00CS P0 |00 d013/ 0pPp Z `0(0 00SPX0`W  `KPP - |q qq cP@WVDUTq `(bP@WV tQ01  `0(0 `000// 0-@LP`0003/P0`0 ?!00` tQ01& (000// -0LP| @` t00CS(0`003/`P 0 :X00X0: -0LP` |0@~:X00CX0:`000Kh/ 0- 0L@0t00CS0`000K0h/P 000 |0000/ 0-P@L`0003/PP| 0000 -@LPT` ` `0R@`0003/TP P| 000 0-P@L`0003/PP| 000t0 -P`L|0@`0003/Pa -@LP`0|p`0S009X X00CX0:P|r|PA 0|  d01/ -L|0 IZ_ -$0LP@@@|0``009*9`0S 04 d0 13/@59@] -0L|    $d0 1 Kh/9]AQ/ 0 / 0 /0@-0S  0S@@0S  000C SdXxXxXXXXXXxXX 04 / 0 0, 0 / -LY -LMP@59IPp0S al90 WV t |0R R1 000 0K`p1 000 0 ;?Z_ -LDMP`0S (0@!Q QX3p`1pT0 0P0 t0Sx S@  @P80S 9 @(K 0࢟0 00009PPL00L02(4X0 0 \0 T0P0:P@`8PI` H8`0S XP h60\ S!8 Ro T @8PPT``Vt 1AR@p0!11000L0K4/@P@<D!@0#R @P8b80S 0S0S 8@00 0P80䠟(4X0 0 \0 T0P0:P@=8P` y8`0SXc0P`0 G`05X0\ ST 00C 000C0t0S ȀDS Shd -LTM@P0S^ `t0S SZp 0 hP~ (K R0p0 !11000L0KP[8P40cKK%K p iE$+4pPKh K 0fPP h00 0ES1 Q1 ~P嵏Z0SY hd JZ_ -LLM@t0PS Srp 0 p(K0S] R0pp0t!p11000L0KSPK8@40c ?K&K%Kdkt 0`p&K0DZ! T0@00 0LP P0 `0`D V `! pP PFP0K00@0 0ڒpP YP P0pW0SVpڏ Rhd YZ_ -LMp`7$Pp0S AG70 UT t0S S K@P iZ_ -@LP6Pp0S a70 WV t0S 40 1Kh`pKh/0t Rp0 -/ -0Lp0P 0-@LPt0Sp0 00S K0hh0\03/-P00 -PL@6Pp0S a60 WV b 9P`p!PP $0P0忎P p-LM@Pp0!"KL6p^PP6t0ST Sa;60 SH11412` Q@-6  P. \ d6@@6040C0 H t0S00Q6X2#K0t 1R 0 0/X8600S16.6000d0 1ᢱP $KpHt0S K ,>XȀZ_Z_ -L M@04 4p0,0!$!60?<KZ_0 p00⶞D D0 4S 40 60CpS//] -t0LSp0 X'_ -L `p  n5"-?  0Sa00 000a00pd5Y  ,KopAUTt@t0T 000ȀŁ -`pLP05"-0?ATh5t0S p0!SR5.P U5p0@U p000S I5p00@5B5AP0@ȀŁ -@L`P40?ST T|)5AT0tp P@T pP @45P@ȀŁp00/p00/ -p@LP\`4 R 0@0C0 00004 4Kh4Ȁ -@p0LP4pbm ?`Q|Q010p`p0@L0D04T  KhpQ00ȀŁZ_ P 040////0  00-L@P d 0ک0 .0ө0000 -LM P0@"U`TPpZ W0040 000 U}Tk} 0 .0㤩$KKd 0㟩#K .0㙩(2(吃"K0"d 0㌩Ÿ,1#<0#80# <##K 0܃K#K T 0YX#* < #K<P   ?#K 0#K < n#K<P   ?#KYX 0耟̠#K@#K ?#K#K 0YXCK 0<0C@_!5 0 @P㔌 圕) 0 .0 @PT0@P(K:m;,n -PLM0`"0"K0 K#K 0K0 "R0e0"@P&> p\!8#@TPL"0ר@ 0@!0 @TP"0ʨŸ@,1#Π@TPCKLX%dq 0L^.!1 ?@P#KP R0@ ,#K R0@#KP#K R0#K #KP R0 p#K R0YX#K   n#KR0K40.@ @0d. 0K_@P< 0X< 0R (K:Q:,:mnP/ -($PLp@ :Q#R000$00U (0P`#V0P9PQU" !$+4P Y8

.^R0a  7P`Z_^[_[_P[_ -LM@\Q"V Pl0)|`P Q00 p- RU0$X 00R 0$U+0 WUT0PTP  WP0PPP%0X00 $Q 0p 001/0P 00 -00(K 50 000U 8Sb0S -LDMpQ@P" P@000 140 #KR0#K R0R0J4 0(Ko(K -LPP 0SUo,`,PwP@ 0!QP@A`,,@!_ -L M`p@P`F 0S`BU_,帐`}, JP  EP  @P`&;;S+VĠ QP  0xx` *"K-#K"K 0K8/``,,$K!_[_[_][_ -LMp@3`Pg 0Sf0h0Sb p 0⇿pP:d1W 7C 0CW 70W1 P,01W 1C37CW0X h020 0$KkPڷ sP aP0 s**+* s$K0X h02\0 0PP p0 g0SppC Gp PP}d(@zd@d@ -goLP+똁p@P, 0S p1 CS!1 01+00$00++0hǂ@+T 0]᧗$Kk+p̰pP+ς⣽+0000000 0H0H0$#0h0p0!"$0Tp$00p0Y+T00T0+Y -LPI@P0 0S0h R00$00,Ko蚃$ R P`0 F69 f&18p嬠WP#`7pdgo+101=pZP+,KoJI -TP`L@0S00go0N*1 CS!1 01<0 $&A$+DKh p-L MP K`a@P Z@P 7Kp   @P : 0* 0X  X *  00 -LMp@PP. 0SP*Uo*`*01S0d0S 0K PP0 h d00d0P W,1(100(1,1,1(!001`**K -@bLl-"0\0S 0S 3/b- 00-@L /P0K0h0^ -RLM@` 4K, pP, 4Ks0 ` 0 B ^\ 1p0% X`ß v#zf08 0 $K谸## p-LM@P`P 0S 0`0 0 y+KpYY p-LM@`P 0S (0` 0600]+KpYY -@`@LpIYP0T*0QU@坵ኟP0償P0Y0US $KkvƁƁ -QLM`plP)t@T) KW 01S@ dKBqe KX0 l080 A(Ht/ F*$K+dK&K R0`p*$K+&K R0gKdK`p$KVgKdKR \gK'KR0$KV000 SQp0P 0p0t0  0t@0 &KfKSR<ƝP83(X XaT'pKJ(K3 0 000ZWbp  RW' @bWX6 8'p080Cp00S  . (PWp<L D0 倝PD0L p0W !D D0W0 ⋣P"  W 0_W8'p08 0Cp00S  . 'XTn'pҬM` #oFP #0 c <P `21 01@0/10p `0p%* ! d 00*klP@^ @ @ `<0DC$KdKWV' 0_Y+\_|ƁƁ1\_U-^W\_Cr -LM0P1 0GK p1  1 04!CKlD 01 &t@T`p004' K1S0S"`Dz Kn KO0e0K0 dKn*%K+DK$K nE/KK⚱`P 00 0@ -@L&PKh7`__0^ -a fp0LM`@`PP@ 0S9`aV@ 1X 1X @0 00p0 0۳p@ (K0@    @TX tp 0ą` Q V @ @T 0 囅iᘀh$r @غ p-Pp0L `0M@T`P 0S 40`0 0 !Kph$dQ((Y p-Pt0L d0M@X`P 0S <0` 060$0|!Kph$dQ((Y 0-8@L ,(2P0K0h^h$Ɓ `_04!`0<`0/hR \0R T0RP0/DR :80R -/P-//|fwt@t,@{f@~fvt X0- LP0@ 0 P$ 0 -@H2HL 6M040 /o"Q Rm X   B 40 Sr2Y2YT3Y3Y3Y3Y3Y3Y3Y3Y3Yt3Y3Y SR 0^PS P` X `fQ010!80 @1pI 0$1000  8 0u0`WV  PZeUP!0S  gP  0S00(K R  R00~ 00 X 1#u[[[ -p`L d0 [@H0*P0,Py(0 @Jغ[[[ -P`LP @0@  [ -@LP` ὕ\y$ 4 < 08! }: 0]00StI/კ -0LM 60P S@ `p`` K$K@P `0 w@`H0 $]@K"`pb`P [ ] p-LTM@`T N|Kp0\K1 4 ) d x0@0S  \KP6| T@P@ .|U k`_ 0-@LK0hE A0-LP@ 0SE@ S@0 -P0ML00  @P 0@@ 0S ` pP?o2 T0S 0 00 00@(K U\# ᩨ0PY@T  0 H@ [ -L,MPUp- `A PU0 S#S` R 0 R,#S 0 0 P pPP P0R S+ P (K.`V30 0LK LK]P `P0V`00P0 P0S ᧤ 0#PP [`_ 0-@0(ML 00@@ @@@ P0 0@0@ @@@ $Kw$  0 "00#0#$0  0$KgGK0`_ [`_0S  0 00/ @-@`p` @`p`!A`pa -`@L PU 00P@H0P00P`C?P] -dLPP@ Ÿ6Q  ?""R0PPV 0-PP@LP0S0P0  R  K0h0 0-@L0 0R 00(0,000K0h 0-40L@SP 4 s40S,0S S 00 000Ɓ p-LM@P` ᎓H耟0P 6!:(0 6,0 "K  0K 4 <(0 4,0 "K 0K0 0@0`0*-: 0 Kp`] -`@L=0Ap!P4!x  200S60S50S 0S EpcaH_P1 Q 50S0 t050Ɓ?Y 0-@L SD0S ]$PK0h) 0-@L50S0500S K0h% -LM(K,KpPPEo9@00@P<41`x00vt⽇P  \PPPPPPwspPp 000`S 0 y8`@,0 (,P KHYƁ`_Ɓ] 0-(@L,0S0S00  <P0 0S K0h/] -`@Lplv 0RPZb50St⡇0550U R  00 0S#P> 0 0 0   P:0 0000( H/o6"Q R  R   0 0  pPP #P 0SPU  P P K 0-p`PLUV,.@U@1 bPE`0`_ -@lPLp` 0S$0C(@D R (0S $0CS p`KhƁ`_Ɓ -p@LMPK CoK` 'p le 0` 0   0  P p h0P?o20S(KƁ(;Y -pLM`KP` @0K\0 0`@0 0 0 0000 0g?oP20S  BP (K -pLM0@x0 l0K | t0 pp W,@ T@DX&l(K <0R!S (;  0 Q 0S K3/P`@T @DTS K`WKt000pppG ! 0Z ``!PV`0F?0  0PPQ 0S 1, `p`pP 0P P60S5Ioᩒ 00 dx0  q 03/PYP Ɓ -LMD0S 00 Ho K 0-@LP @T $@DT`T0 PP0S(@0 0 0,YP ƁƁ]!a_OYa_ -LCM@p `P 2SJ@ @0 (@ 0@S Ke0B/K00I/K(0000$Q  a KCY -LDM@P T-(KQ 4Б +1 @@묡 !w ,0K@# p` 0,p(`$@ @@ @ m00SD 40p0,010 1000'> 0 0(`$@ @m0040p0 ,00000(`0$@ @ @m0040p0 ,0\00T0(`$@0 @ @0mƁ`_[lǁ`EYCW >0W >C 0CW; HK8Wp 60W 26W+x %! 哔80 ip8Wf  ;C0CW 0CW 0W' 0CW 060T 8W =C?0CW0@0J PH7W 7C0CWb 70W 7W HP37W6 70W 5C7C 0CW|0 0QS 0 F0 0A0CS…Q07 pW $pGWP0PS0PPP(K00|z0S0S&0 R 501:S 00P0PWU PP`p(vPPQO䀔`DrX u UmU Ϲ pP ǹ\+P rPp 0S]J4 R!PP0400S 00P0S 0!H0 ,21L ,24 pW9 Pᠤ$pGW  H4L!,210#,2|0H R0S 0S Pn00 @KP0   sPP0 @K(pW $pGP0S RPp!h `V0 PS R (`V $`FV0S  P0A Q0X: KPP50(S10SP PPP 7P]0W S 00,0p0,0`0,0S  Aq0,`p(pЀX0mp1Wi1Pq@P 01l1q# 0 PU0S0 0(0(,0 P000P0(00,008000080<00S<03@00D04PH00,0`0,0p0,0S  p0,p`"U8 PP0402  L`+kB@|B@tB@oB@kB @~f|flB vtfBƁƁ[?BWa_/P/ -LM K)0`( "4`# K0M0000# Ѝ/:9/Q21 //0@-00S CQ00 @APP^0Q@  Q0 8<00 00  0-L00S 0CS00 APP0 0000S000/AP/ -QLMpP`A @@S S 0@ S) S S0=S SS S S S S @S S S 0@D(S &$S S S 0S: CRS( KG(0@S%S 'S 0 S* 1 3/00S{ ,S -S T5S <S 4S dS 0LS ES @Sl DS 0@GS HS  *0SK0CS @TS MS PS  A:`Sm aSo \S @qS |S lS tSz 04CdS2 Ss^S S Sj S S1 Sb 0@$L @J @$K 0S: CRSP( Km 0SSF( Kc@-  =*0SV0CS7p@ 0S S,( K(0S&<  @ 0A 0 0A 0 0僁 0S* 01 0S 0 0S 0 T: T  @ @DY  HY y@ @ @$I4I 0 0@ 0C@d0 S0 1 -LXMX0 L0KT0 0` \ ` KP0 K -`PLPp@ Y@ @0G S*10S0S,  1 0@@DTnYnY8nYnY$nYtoY0@S S S S S `S0 S*3 @)0 S*# W@@PT T T T0T @TT `T pTT T@Tص0 S@ S S00S*Z*0@1 0S @S@0#T0#S ! 0 S @SV @T S0Q: K/ -@L M$PK`@%(P pX T 0 %003/P@QP,,0 \( P0S@,P K 0R0(0  0 LXǁ\ǁ -LpP< P@ `0SRx-0 0$Kk/< 00(0  @@@$KkXǁ\ǁ/ 0-(@L d 000Xǁa_ -PLp\0l`0@TT$Kk 0R00 0 8/ܴ@Xǁ 0-(@L700K0hqXǁSQ@-Q0 0:pX@0 AS^ P`00E.LpLLt] -LM@pP oK0  0` P 0 Ka_ p-AMLM0PS`@ 0S0S08 Kp (BK0 0B>K a_^01,!,"/0!,21 ,///////0 00/ /H@o/  -L⥅, -`L$Mp@KP=0K@D\V\0P(KP& D R 0 B R@ DP 0DSWP0S P  00C ^ R0 T R XX PU@0[S @K H CH0S@PKa_ pǁ 0-@3L08@h9$0PU0(0S 3/XP$ -L M8 ! K+ -L M8 ! K+ -L M8 ! K* -L M8 ! K* -LM8 j! K+ -LM8 U! K* -Lv, 0-@PLP00S00P00C0c, 0-@L(?0 -0pLMPK` @0 ؄\0`K X0P@ 0 0 000 0\` Z?oP20S(KtY 0-@L+(۲K0h 0-@L7 +K0hs 0/Q0SS// -PLTMp P P0P 08  0 0 <4P0,p(`$@ @ @Oa<000<8`04P0,p(`$@ @ @`0 8a(KH H0*P< @ 00 )8 404 gwY%f^xY^@xYa_<^a_a_,wYO^xY͵^wY -X`P𝤀0 !`!800 (  , !,LP// 0!< 0`4 0 (   !/,LP 0-LP@K0h -LP pY@0@TKh00S `3/adX@$ -L@P(p` 0R7P*000) U(  ) 3 000SP0PP00P -PL@Uy2`S 0C8C8S25/o0S0(Khw꼻 -`P嘐LYp:@T 0S0000C07KT%(P 0 03/03/lǁ -LE  0 zY _|0Y -@L X P0 P`0P  LHH`@C 80P Kh$pǁ@[a_[a_ -L@M 0K #0,(TL$  _ 00S  K耬Ya_㨰㧰 -LM0  B K^ -LDM0 S(3!^00@p`(0200p,`$  00K_P= _20S 70S (b(v( d[w0T"TSSL20 00<2 P @   R oRl2R@"<2o M@h` (K 0!00K$  ,p(` H_P 0!1$ 000K ,p(` 6_P0 0 0!D1$ 0,p(`40K0 K"_P0 0 0!0$0'> 0,p(`40K0 K _Pv0 0 0!0,p(`0$ 40K0 K^Pce`@2S ?S =<2@2_S@2 M@'h@R꬘YLb_a_$YDyY@[Ypǁǁa_<^a_a_ -LDM3@ l` P@VJж p庶0 |(0H1!n00,$  p00K^P@ n(K 0!00K$  ,(@ ^P 0!0$ 000K ,( |^P 0!X0,(0L0$ P00 0p40K0 Kg^P Y(uYLb_a_a_yYa_ 0-@PL01J  M/ K0h+`yY -LP@E`& 0R 000'Z(Kh7000S@0@@00(K1 <0 8RR00R0S 0S/P2KYDyY -3P`L |p,@P IV0`0PB uYY -%`p@e(LPP $0 0 03/0Kh/lǁ -LMQ0P@TODt`0L K 8K*% P8K:@BT ODTpǁ[ 0-@LT00P00L00H00D00@00<0080040000K0htYtYtYDyYtYtYtY~Y~Y 0@o/tY -@L`pLBTD@DKhH0SDPCP00S7/@T 0-@L<800 R @@0000K0hpǁ 0-@L40(S   00C0K0hpǁ -p`@LMPu@W@PKUPT@\0`VT  ,K=N0[S  ,KPP`@Dp?Ppǁ0Lg[ -0L$Mp80 0 u{9  4 ~1P,s@X`8p4 80p 0 0l100 b1 $0(0`00`(K蔣Y0y 0-L@0yP0K0h^,/ 0-@ 0 L`  Dp  H0D0LRU DPU?D0L2H0L2SH  eLr0KhxPH0S D0SH0D0H0SH H0 eHp!R00! H0SD  D0H 0D00H0 Q-L@ 0P 001(QUY`0(,1(1KhR 0-LM,1@S K>P(Q0xx0,1K0 -@`P9 L(1 901U(00Kh^x0 L [0P/ L [ -LMP@`p0(Ax(Q0,1;EPLBT D@DTYs K8KN @),8KPH@ -LM3@03aNp`LRU DPEU-I PP" 0S00P00C0%0K0K`HP,0S 3/XPUK"n20P$ -LWM@._K}`!-^   P3"0 3Q  @" R<<"@7 0Q$P 0?S@ Kh΀a L0 0WVp `\` 0@\ 0@` 0\ '\0` `0\ \0` `0\ \0``0\ \0` `00\\0\1<\13# 4P"3 1P1 3P!3. (:0(03PK31@0`@1^N D! ! ?$8 I|2M8 B|h X{_0 0 0PP0@S?P SRp @L? p@`P @CP$P @<$rSPPiui iiii0L4[ -0Lp0SoCP @0SLB @2S oCV0 R H@T D@DTP 3 P 0S PpǁtY -L@`TP@P h -0L`PU_Ep @0S@RU _EU3LB T D@DT 0 0R H@Q PpǁtY -L@`P@P & -LX0S !S* 1S  Q(a 0PU` `Đp_EU0 SLB @RU _E ,  H@T D@DT 0 RP  0 Q:V` 'P`tYpǁ -L@`P@P @ 0-L@ P0RP0K0h -L@`P@P   0-LPx0@T/Dl 00SL2 @BT /DR@00S H0S D@CTpǁtY -P`$U00 LP0S@LBT D@DT&  R0S P Q P  0S*p0  0H@T@tY -L@p`P@P + -PLM`@pL0S Q P (00 KPP (0, SS  3/0KK蔣Y Q0-LP@0υ0 R R& Q A PT QG#1^8C8 ^P  L0^H  D24gDK0hQ 1b_b_md^$b_ -L@`Np<0S$KkFPF_oSRP<`U`  .PU 80S 3/XPPU 80S 3/XP$ -PL@\opW밀\0(10L``V 4D$Kkع -LPpH@7X` 40 0 H ( pLB $KkBP H@T D@DT  Q H0S D0CS0L2L0S pǁ 0-@L  K0h3 0-@L  K0h'0P/  [0 R0/ -LP 0RtY 0 - 0 41<0R4"@ L(R /.\1`1r D}23,p  AP4 ,2 Df `@b\bW3 $03/$!@0S  u 0u kd S*.hR SO  S, _I SF *.SB 'BO BTn@@k@@&i@6@5@7/yizipǁ[tYiiiii{ii8iui niiiϖo7.iiii -LpP0`@TOD@BT ODT 0 S 90S,1 0{P0 pǁtY[0  [0U[ -pL`@PP 00S0 P{ @P P iWb_b_ 0-LH@ 20yY 0-@L (K0hzY zY -xLCMQpP@ X1Q -`H!   I`P TU `e4V `(K |P  0R K5LBT1` KKKKKK`PW14 T0W -`D@DT 0Q H@  k41i i]b_ -LM@ pQ `V Z⥣ V3 $0K3/ P⚣NU+ 0S(  KMt KItP`@K0S  s  (0S  2t .t$K?P`P@70/ -`QL@P  0R 000~7P' 000SPPPP000 0R 7Pb000U`0SP0PP00P 0-2L@SP K0h/R  0$K0h/ 03/P0iXi#08Q AA@o// p-LM2PS@ 3/Kp3 !j`V 0# R3 L KR@/s0IK KX3/PV3`&c R L KR@sIK0 K3/i 0-QL@$P U0$0 00ES$0P$P0 0-@PL P '0 0-LM2@SP 3/K0K0 K 0-3L@A0@S AS S0 03/0|2S 3/4P00K0h/ -L MP30 N0 SF00t` @ 04#DD0HcS$Hp40S0 %000D40pT0 (00KC50ß T  T0K  0K0 KQP * bP0 $K0 3  ,10yP  4y0P<<0) 0  0 0:00p((#  3  ,!0 xP:00 0 0KD P00S ` @ 04D#DH$Hh20S 0T T 2TC 00 P I0SF0 $4"4:#:S=0 :@04D#D1H$HT TP.00  U0 0:0d10T KP1T+  T@1@0T 0  P] (0S%0K %0[0C S00T 0T00S002@@T  0R000 00  R000000b9QC<aPAU A7AA00 \0S?p-0C0 S3 pp -@LPT` T% TB 1o  0@H  &o "o0@0^0@00 0000000S 0S 0S @T Po D300000000000/\]b]h]n] p-LM`P @o$ K,K`P&,0[- $0[* X"$K,KP 00 0 ,Kn $Kn0 0X24`0SX2  0XB0@\20\2T ՜Kp` p-LM@P.$ K,KY`PX"$K,K@P 00CS 004`S  0 \20C\2R᧜Kp`I|// 2-QL@`P -l2Qy `2Ql X2QX  Kh$82Qn M0Q`2 Ÿ2 0\00-\0Sv4P3, 0Kh/1Q 2?5Q1`20d201Q* &0Vt"RA 0KhU00S00So.3A AR 0303/P PKhP2!4<010`" !d"S d2KhKh:x"R0Sz 0 0 8!tPoi1iii2i(#iX8i(it] 0-`2L@ d20d20 APd20d2000 0-h2L@S 0d2 0d2 APd20d200 0-L@M (00@pl!0$PK@%0 00,$@ @@ @p`J 0!@0,(040$@ @0 @0 J$Kb_Y^ -P`p@L0S 0Q  6/P @ 0-6LP@@0,03/ 0&@P@ D&! R!@A0000 0-@PL)%0|0S0|  @P0 0-@L K0h6@/0S   6@ H0600C0/ -@0`0LP 6/P $0|0S0|  P@ -L`MP`@XK4 pfl980"lK Tp PE 0P S6 00p0K0 0XKb"P40S1 \. 0S+ 200#0Ѐ0`% R 0l  6 5;  & ;00X0p  0巬P00p 00$KJ@J$ -@PLT0SPP`T0P`P0CT0 0- L'@P k0ǁΧǁ 0-6L@ @& @0@03/PaP `Px00Cx0x0PS L0S 3/H03/00Cx0$ -`pLP,%$0 3/@,x$T3@ @,$0 8/@,d$T x00x0]$ -@L#@Tt$KkM$0S @ 0QU`0Sp#\7$P`ǁȁ -d@LP`p#@T8$Kk$0S$0 9/@ǁȁ 0-PLLs@Pn0  R 80<000@0,0$0(080$0H00 0|YdYtYY0@PS0@L f0DO0@Shl!R R 0AP  f@00C@0@ MT[[ -L$MP!,2`1H ,2@p|`@KD @@0T : @K*!H,210#,2(K1 3/@[ -Liű 0[c_[ 0-@x2lPLS|"|"|2x" D4D08D,D( K0hC[000S/p"Rt"R x2[ -L`PP@ &@pbtRNu$0 @0Rx"||2[[ 0-L@P0 K0h -L@Pp`     -@L`pP 0 PP@ 0 PP@TT 0  0-@PLz 0 -L,MPQ00 D0 h`P0' 0L0 ,"1!H0 ,"@p`@KD @@0S0 @KP0 'L0UH0,"! ","D P0 (K 0 DK"0000 ( $#0 0  -@LP`p# 0 0  \:00 Y0 0A P L `0S: 0  000 @ ``A@ -L M4bpP0Wp@R W p(p(KT D_ G_PY*0U ES 1 PEU WPPW BaP 0 P p  gPpWX0+P p  0 0` _ 00 K U00pSP@ 㭨 /@T* R l  RPEEo@D10Q0 00 00 W@É{ȁ c_] -`QLP 0 ]P @@XPT0SP -L$MP0`Q< @80  ;P ` @(K00 K<00@S@0 4 0p R V R  QD0 H PD0 H PD0p0ST7@p 0 000P RPP<0 0000@ 0V `0 0 000 0@0pS/PUP0S$0S# RP0S00000P0pSP0S 0SQePPUVy 0 Sԡu 80 SWPPUIcp0S0 0 P㡧Q V 00 0PK P Ppc_ -PLpQ`P @ @  B[fPW6  XP 0@  R' R3 Q0 0' T! 0S 0 P!P࠳ࠣS^I RHF 0 @T@`9R- H3 00PSF T0:`P R00#0 P0 QPP(0P,0P 00 0#00#0 00CS 0 0Qd1  0 0R@ R   R00 S0Q00 R Q࠳ RSR ˦0Q `U P0P0 RPPQ AQ  0 gd_ d_ȁd_Dd_0 -`p@L0S MPT 0@ @ 0 @6/P -p@L0S +`TP 0@ @ 0@7/P  0-<0LP0@S0 0P@  0ȁ  -@p`Lp c^( P0pX 0 0p0d0(0P 000000 0ȁ ZZZ0 Z 0-0L@SP pp0P 0K0h00 0-$AL0S  ! R SP K0h$X P0CPP0  ] 000P:lPdPd @T0PD 0 00pȁd_$d_d_ȁ e_ e_ -`LpP@()*'P` 000q100S0@@P -@P0`LS   000@7 0R 0qKhع1/1M/ # -`pPL0@TUH 0 $P=M,Ko#!0R"1S RP dP P dP 0SU P 3/P @HP 0 w$P ,Ko,Ko  #/0 ]0  ] -PSL`p 0S @1W0 S 0 0 03/@P 03/W@ ^8@S9@ -0LS (e_Q00S//0@-P\ @0  S:S0( B0@\ -LM40 0 P @ \ \S R KK YcoK 0-@LP V0P RP N000000 帶ȁ -00L@SpPU 0S l`aP 0|0}0 -0`LPU, p0S   0R0 0 88V03/+0S0C0`帢@T " ̟X0P0$$ $$Kk-QȁJȁ3e_ZɁ 0-@L(㧊0 -@L8P,p`80SKh>n\ -`L @T@Kh+p0ddP 0%8B(1LLp0C(1HpG>\\ȁ\ `P/0 !`8 0 0 (  , !/,LP 0!< 0`4 0 (   !/,LP -L8MPp`PP @P 40 8xU$KL!W 4 XKv[0XK TP @ʁ 0-@LLPQ0Q ,0 P L ,00,0P,00,0=LL@<0S0P0K0h6 0-L@LPT 80S 3/@P 0 p-@QML  @@`0 0@`00c00@P  = @Dr0 0 `0@@p库l0 (d0 `0@@尓 @@Kph}\Xe_\Z`e_]]^he_re_Ɂze_ȁHZ _? 0-@L8A4048<0S0K0h\ -Lp`P2YP@PG`P$@0S @P 0 0R 3`P +!@ᤥj40 |H0LPD@ ᑥTL@T H@T DDP@@ -,0LPS`(V @P0Q  (P@! 80S 3/@P 00,@S 000VY ``WWY0 V 0@ \ 0-@LP0}P 400 C 40ˁ 0-PD@L 0 PR0500 K0h2\\ -40L@ 640|t`tPPU`d0P`@10L`@ID<@\\\ 0-<@40L@P6400DP0T0K0h\ -PL@a0P 000P i40P %p`0f0 &WV&ā 0-@PL8M4 HKY04 HKD0 00@0 0<0 H0S(1040 L0000 0 K0 -LMp`PU@PPN000P 00c00S0P  x  NN00{@P  9Y0` 000 @D0R 0K(\ȁ]TZe_]^Zȁ/ -P`pL@T0S  0 0S   0R0 0 8R03/0S0C0nȁe_/ -Pp`@LT@P7 0R@S   0R 0 0  0S0C0|?( Xd0`P "p00S0  @ P 00 0@ @ 000ȁe_Jzx u/0@-40@ CUTP04000ˁ 0-P@PLP0@P0 -0LPS`  Q@@ P  0-L@PQ0P 0P C 0ˁ -@LpP`P P U00P Kh P U00 0-L܍@ ƍ0dZ 0-@LPP P 0 -L\M`pP  0yPPPUP@T TKl|K @PP3Q U +P PH@ $QPPTPz RTP @PLZ}T|KXhKUU H0S PHP (04 R0 040L0S (0S  3/Y  R 06@|K)@KTK(KmPP7hKP P@K0S0S hKPh K hKPh K<P0 U |K@hKP P@Kh0K4PwA UYy ePuZ (0S  3/HPhU[ @K:W -LM@ L0 p0 (0 0 T5!,21 ,20P0 P`K0&T T  T P `$W  K묀K hP  q@P 40LP0U40 ,0 P,00,0(0S 3/8$(10(10S @8PTd EE ]E⬐YW 0 V0S P`p0S   0R 0 0  0S0C0 ~8P4Ð@P" V0600400W0 K  P P 5 #0 00S P7AX P !PAL`<0S0P0$QEP 0*P1P 0 H0ἀOអ1G P ᒢ 0SK-`!0,"! ","\ (K(pW 7/0S KK0S @8O B@P@BP`W  K묀K `P 0S. 8O*pT* T T"p,`V00 P@K JKP b`P00 53ȁˁe_ɁXe_\ -PLTMptK@`P|  $30#P00Sx [PA ᱠX'xP 0S 0S40 A KI 4 `K~U0, K@L0"`K8@ \p XP T 4` Kx (R4@xP o0SQ4X1  04 `KTU0 D0 `K0\p XP T tK(K0Px0L0S Px @4  4 43Z   0 ʁʁʁ -@Pp`L8M4 PKU0 PK(0 Lp H` DP K 0-LMK,@PPnTK0 0-LMP@p0 " Q`) 4 KT0, T0 &0  KK0 P ` pPT`! T% T)Q` R K`K0P L0S XAp3p K(0S K3/  p-L P/0@-4 030 A30  $@TA@00J -LM`pP0  @P .(K8M (00K040000 P00H0PH 0 㗛f_Y ( -L T]0/ 0-0L@SPp7K0h40 0-L 2/P 0 00- @ L4/P0 00-L @ 4/P0 00 00-L@ 4/P0 00哚]^ -LM$0P    K Kˁ=Z -LM$0P    K Kˁ=Z%P0/ˁ 0-404PL@T00S 3/X@$ˁ - 0LN7f_W0!,21 ,/L0P0  0  !P P  /$ $/, ,/, 0 /ˁC-DGDG EH@EHFICFCF؆ 0` p 0`0X@`pi@JJ-/-/-//-/-/ 0-@L-0 0-LM1K"0`P2KpL8@T 0S80<000@00C@0LT 04 K1K,000Kع,<ˁ -L 0S V9 -L 0S O90"S  0S  R  3/*///-0"SP P P0 \0 ^.0SV**T @ P"Zf_-/\ `P/0 !`8 0 0 (  , !/,LP-/ 0!< 0`4 0 (   !/,LP -L M@`p80P00 00@ KXQZ 0-LP@o0 -L@`PR  -L@`PKh -LP`$$00@upt `PbX0 0P0 0V $~001@01ˁ, BZ -LMQ 0 @t  Ps- (K\^pDh 00 l d hP ~h0d l0 0h0 00 0|0 00x0 0ct0 0p0 ` 0FSKZKZLZLZLZLZV$|0S   0S K7ZdJPHh0S t0xR0D p  BR 3 PE0S 0S  K"PKPP&UV0 V004 `K0 O4!,21 ,2弚d4@PU00 9К 0SK2 0380@ P`0 0 p>Psp0@p@ 吚0LBT D@DTkᤚ0@0 T0 H0 傚K@@RU _EU |0S "SL2S DS Kᅚ(1 0`KL0 0K00KVPp0L S dZ t0SV V VK2 @T :6~ ^TxB:h2 @T )6T~ MT 8B$` KK0:/ ~Z NZrp R  QbK0 0+0VH0 0T0 0@0 70K0 0K`KP#p0S d0S t R " ,  4  `   R㸠 RԠ pd冏Pp0 0p0 ؙK rZ0 "͙ 0Z 5u~0ߙZ ` K$0K3/T h~H@!P lC} =60a2xEZǁ@4P4442 0-L,KM B0" X AK !1 0 0 ,2p1  ,2P7P e(K0S~pP 0<<墕(0wS `V `P@` ܀XP P V M11@700ST $@P@ `7P 0 z0S`+P`  14 41x0K0.N x0 Y``\`VQ^ 0 \ IoXQ Q  a  0\00 0S 0$S0S 0$S  0P0S 0/PPPK LN I MԀ 00CS.TZUZVZVZ0YZ0YZ0YZVZR  K 0P@00SL  R% R $ 0PKS0 K]P&P@PU P40 R0 KKiPP 40S  R  0 00K00 0P00 KKCPP0 0 000 00 J2zbV $03/d z;TPp `V *2zNV $03/ zK,54 -LMPp@P! 2 P20S 3/200S- 11 0〢1 4 KK1!0 S St STm T T   01 Sa SYS SZ 1S(K]S aST TK T͕ `0V  1uz 1ߕV $03/` jz`(1 ` 00 0K0 00 00 J2?K400 ,00 1141x00 0S0 S000  0 KK4P 0 V W 0`x 0 00K0 ` }JX0 KK141x00 2:K400 10 x0,@2W]f_P2D2 0-LM 04 K -LM+ K 0-LM  ! K -L8M00 00S @0K@P [ K, -L8MP1`00S"  P0K+@P 0 3SH L0SP0\ 00<  0CS*pPK kJPp0 (00(00PPU 0 TJ000,  P-`@@@LM0SPp4 K@I80"9`p pK ``0 Kp  KD$ -`pDM@La0lp,PK@%00, 0 ($@ @@ @p`L'0 400!0 0000@0,($@ @ @7'0,00(0(0$0L0 00!<0@ @00`0 0 '(K\JZf_ʁM_ 0-D@L1< "40 ((D0PL0,f_@Z 0-LMPP @QD00P @PK00S 0S ` 0 /ˁ -L M    0$ KˁP/+ -LM@pHP`9E49,10#W00S 0 8š440L  80" K/K30`K0 $4"48C8S0 00/ -PL@`>P =Px00Cx0x0$ 0x000Kh=mZ R 0 0 0 0=ˁˁ0  ă 4,48C8S    / 0-@P`pLML!|3(`00 0p,P$@ @@ @,& 0!03(`000K 4p0,P$@ @@ @&008p40 000'В!2(` 00,P$@ @ @P%008p40 000 00!l2(` 00,P$@@ @P%008p40 000!202(`0< 00,P$@ @ @%008p40 000 00!1(` 00,P$@@ @P%008p40 00 0 00!T1(` 00,P$@@ @P%008p40 000 00!0(` 00,P$@@ @P%008p40 000 00!0 (`0,P0$@@ @Pl%w}``r0,@  0(K^i_f_&u^ gZM_f_f_f_{^ˁ !>0- @L0G00 00 p-@LMP6@x0S L0S 3/H03/ Kp0Cx0H@0`C,6@'  4K0 4K{x00Cx0u@| 0#K܃K*||܃K)|,x0SL0S 3/H03/0Cx0ˁ-  0/ -LM`PPH 8 90R 000(@ G80 S00000 09p0  p0  @0 YG@0  SG? NG`0,@K\p1d0<0s| !s|0 (Kˁ p-SLMj`@RP,K,@K,1l1 03/@,Kp 0-l@LP@TPK0h0U@( ;HtK0h~ˁˁ 0-@L0S0000ˁ -LM0  <00S K0K @ KA]f_ 0,  -LM,K,( 0 P0@PU 04 K0 IPK PLK{&`pf{0?P 3 KFu KF00  [{#`pc{`V`VpKph;尐d+0 0 N0 QU PEU*UpW/ pY ` P 90R* s{$`p0 $u{ KpK9 0 p K⠍U K]Q Q PUU KGU-00 婐`YP K8ἐYL2`SDCᲐYI,{%`pe0{00S` HY DIY9 4 8LPXI{&`pf{ KpKp0K ,B P0i0 0Sbxz% 0%z0S xz$ 0$z00USڴ0 S S0R00  0 80" pKm@ K POTp  0 \K0p0PI  p0K ^ 0000  SXwz' 0'z00Sʴ KpK0 0\K⮾p K0 㷌00 0 #448#8S ShFhz"`pblz^ 0Ɵ R0P0 ,Z tp0K㍌I00 Sp0KLŝH0S= R SPK\K0\ KKPP\K`, l1\ K0P5/P,[V U f00 ` 9  2KP 0 0\K;6(e 0u z 0z 0S KpKp0K ,&0 KP@  R y 0y0S p@K Ka@0 d000@0y 0y0S KpKE0p K`9 xD6 &33  ?%,0V6 \K[0 \KP 0R6 T \K 0 LP00 0P0T00Rwy `?pj,Kwyky,Ki`p0 )lyp0S 0 Pp\0KP oob@RKy"`pbOy0 S40;P   D,1 0DK / C KC0 0 080S00  ,   /K \K,l1\ K03/`,6V 6p  0S  C  C#   ,@K( 03dx `p` `p`x0 K=(KK ˁ` g_ P PPX H 4 '4 ( L R  ]Si_ki_Jǁ -`0L$Mp PF@P 6 4%P0 9 hA (K3 T V1T2 ,_l1 @ 04/@,Y T1Ckv+ 0+lvC0P 0!#㖈꬐ P ,)l1 03/@,{T(C &ᬠ0* S2%P009 @밖 2 %R 00@6ı UY ,!0L 0 RwS D0@ 8"0<?6S  2%SR  T0S!PP @ )T0P0CT0u  0 uu  0 u@ P0SP0QT0R0T0 @ W@ 6S#W@ 40@AR3 ,1 00@0 0 %066<K06f#Y 0 <K W L0 @0<K@P. L0 @0 Jˁ4Y_]i_?Y_i_ -LMHHr8 ,@T 0 "S00002 00C 01,Tb 0aIu! 0 !Ku0S@P@ 囊0 0PH0届.u% 0%0ucR 0Kpu# 0#P PP0K`0St@P  0 $4"48C8 S  St$@PDt@80(K $!$8(QB( R P PPPعi_ˁ-/ 00-(0,0L@<,00S 0S 3/0000000<008000 ( 0 R0K0hꨄZZ$qZ -L M0@S@P;  04!48C8S* 00S@P% P0 $4"48C8 S  S`0,K4d#dԉ)hpPFh 0  l(K380S VVV`40S 80S<0SP Z,1 X0 VEP 0> >0<0 ˁˁ 0-aLM<00pl@ 840X2 yPP$ 90(G@ f> 0 090  0 ,!D0  >nPD00 ?0#P @<04@S3,! >` ,0K!c ,   4 > @>(Ki_ˁˁ -8L@`ps1@`p`$Kksˁ 0-PL@U0 x0T0 R08 #804 0110 K0h, PL  P   4L]i_j_0  0 R/0Q -LdM<`p 2@   hKP=!Wh`K$K&K` @\K> @K>딈1 `V P(K\K= 0hK3/PPXA 0P d啉LpTp@T0@D -先p80S!<0  S S Rd|`K tX0S lX`0 :/GZ  z4@T 0@DT WU  dk 剉P pˁ\ -80L@S0P S0PPX 00R0Sx` 0pp0彇0  D@8/P0000`0PS404@@#Pˁ\\ `P/0 !`8 0 0 (  , !/,LP 0!< 0`4 0 (   !/,LP -T`LPUF@@8堈 @ D0PP0\0j_:j_ -40L R   Khˁˁ -LdM"`X2P pPK @<!> JK3K4KP`K< :K<n2 `V /0PK3/PPA` 0P  dxKsL`T`@T0@Dt@cU \0d@TaSJ XG `08/ xKm(K80S"<0 Y S Rd0dK 0 @X0S 8`0 X 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@0 P//8@-@P,,8 -@Pp'LM l@  `08 ~00CS )v<:0<: P0010#21Z 0 ?Vpas'd"0&.` 0@` p0SR"0.!0.)]  0 v<:0<:` P)=00 SZ0R70)v <:0<:1PC P!:h0:`1 p`$p`YX R00uv <:0<:1PC !:P0: pW *R R `:S 0)Tv<:0<:VpPUt /< (K S 0 0)<2f'Cnp_?p_p_^^q_ \q_R*0S A/ -Q*  @000 00@#1 2 /UUUU3333 @-+/ 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00u+ B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/QC-Lß0 B0#01 #R" b 3R @@ ^0&'" 0NS 'Qr#S Ÿ 00#01R #  Ƞ ̌ q ̌ , , ', q , ,Ġ  ̌   Ƞ ̌ q ̌ , , ', q , ,Ġ  ̌   Ƞ ̌ q ̌ , , ', q , ,Ġ  ̌   Ƞ ̌ q ̌  , , ', q, ,Ġ ̌    Q00## A#\#4 0Q<1   GT^ -L M0@R(@K `*RP3 R$ P* P?R% [R ^RPpp P\5 ]\E R -\= Q`[R9 ]V7 RP PP0 KP 00 R 0Q p P P P p`0SWp @/o"RA-p"@(@0!!p"0NS(1ឃ!Q Q Q '&' `0@D4`P8<""p"TPN0x'0t'[ -L M@ 0Kc y-K 0-@PL $o-@ (- 0"0X"^ -L,M@@p(0<0 0P80 0H D0 0@0 H0 0KM-00(c(#"$ c$"<0 5e3# <#0@  p  "06f1#f+#808@W0) 00#08D 0D  @W<H qh.ɠ,D <L .P PD', Šb,p,p'pL< @c & !c 8@ 8 pH@P 000 ` 0` 0 00p0p 0 P0P 00(K@ 8 P`tP` 0x"^ -L M`P@) $(pQ ?PU5  08R(!)8 b8, `,5P(qᜀ!(Kb8"P#4b4# (0 ,Wh , K@R )@ b,8 8  ,0(0 -RLP`- ? @p`Z(: ],"(J` p ((?WH? *3ᒣ$T  (B,A?,A"" @pG@ -, " @pG?WH ` 0-@PL $,@ (+ 0"0x#^ J 0-@PL @ (, P+ 0$$0#^ -LM@ `#K v%K!&K!'K"$K"&K#'K#(KPP 4K+K3 0D@ ! D @܈K D K)@(D @ K !K K 0܄K&KK$KK 0K  ! 0K<08 `#>20 ">< 20 80ԊK?"10 ?8 "10 *K)80(< <30 <8 30 +K " 0#$K܆K%K " 0#܃K K&K܅K %K " 0#܄K 0ԇK 0V%K&KK'K'K(K  1!0 " # #,kK3  1!0 K`& p'   "# -#3p0  0 KhKlK0`& p'1hK`t `piKhK)K`& p'0ԇKhK() L0H #790 "7L  90 "9H mK70 "9L 70 .Kp'H0`&L ;40 ;H 40 .K "0#dK$K 0`p&KgKdK` p0gK`&p' 0`p` 0 0KT0P K#>20 ">T 20 P0oK?"10 ?P "10 /Kp'P0`&T <K31

 0 K  0K ! 0K!! 0K!"`p"#K 0K## 0b#(K&K'K$K&K$K$K%K&K#K%K%K#K]$K&K$KK$K#K%K%KeK#K#^ -@@LDQ  PUP`%  0pRPQp b)H *@ *KhR Q b)p p )0P0 -L MR@: @ ` ZP : ) 0#K$`p #0##K!#K0d $P J  ` PpG p#)Q0`p## 0d $(K$ 0 QP$pGWF0#ᓢ%U  P)Q )$ 00 QP$တIY F -`PLP =@ @@T ( 0-@PL @ (X) P( 0$$0X&^YT -`PLP @ @0T ( -LM@ p lK.)p0o00 p000 p000 p0 00 p000 l0c$c\0 0 ?   "  "h b`$`  "  *    db`$`   ! `  )`D` n!@, @ @$@\ꝉjaa  " X (M iaa *  .T 䍈dAbb,  P P)Pbb, L  P%h a$a$ P]  n( @H !bDb,  DeQ .lDl  `@% "@@@$ nDn - a P< *͌b!nTn! )8lA쭊`T` "t (4ꝉjaTa $x  .0 鍈bTbl |  @ i *P"  P%t  ,P%/  h) " "x@  "/  ͌n "@(  "|@P! "/ @ @@l .@$P @$P `@$O@ P@,@00 @$ "@0 -#0ap .0p'M.;b!P pP`!`&,tP}dA,P,ϠP`Pm xP P P"P%P唀gq$!|*]!!  fa' ")孊 " "/@@eQꝉ@$@$@$O@ &@p (@pj鍈@$p@$@$O@ p%@` p'@pt`i}@$`@$@$O@ ` @*@$`P@x`PhMP%`P%P%_P `P)P%` |`tPgq䭊P%` P%P%_tP t`P(P%` `xPdAꝉP%`P%P%_xP x`P' P%``|Pj鍈P%`P%P%_|P `$Pp `&P`pimP%tpP%P%_P p*P@p'Pp@h}@$P@$xP@$O@ P)@ P%@ P@$fa @$|]. @$O@ 删@(@$ @嘠gq ) )M, )韠ጐ &*eQ .䭊. 堀'.`t`dA,`,Ϡ `% ,`px`jp `͇  ` $ `PP Pn!|P!P! P* !0@0l@ "0P "0 "? 0   0 @06`p@ @ -@$P@$P@$O@ @pp@aP@}@@.@$@$ PPt@b! ` @.͌@$@$ ``gqmxP P%P%P P Pl 捁|tP!P%P%t   tfa  .! 蝉!/x x h p  " " "/|    |i  ͌" !t !/   n` -@!@$x@$   l p⍈! | ௠ pp b!`! p}   ``hP`!m   PPgq  P]@!t@$ @$䟠@@@ @ faM"x ! !/   eQ   "| " "/    dAp - . . a` ,,   b!PP͌ P   PPn P@tP@ @$P@$P@$O@ @@@l p.00x0p'0#``,0#`&0#?0 `0 p|t }h " "P  "/t  x `yZnܼbm" P%gq!!/x   | @(@$ " P] "fa "/|  @ " M!t !/   '! "eQ "x "/  & "pdA%* | - ௠`. a  $P,Pb! P͌ P  P! P@@tPn@)@$ @$O@ "@ )@ l!x@ .(!@`!@ @ p, p' "|@鍈i "@ ` `& "/@p@}h.@P)P%.@.@ `@mgq,@,,Ϡ@P@]  @( @$t @faM ) ) .')xeQ䝉 ( (,Ϡ&p(|tpdA鍈 p'ଠ p'p'`p% p'x`pim !!P $!P|h]! " "0/0)0#@@p0M@0Pp0P0fap0`0p0 0 p0(K000,00(00$0 0 00000/#EgܺvT2 -@P1L00>! "0%?0 0%0?S`p @p` #?0S: EKh#@p -LMP@0$`KS  !1" 0S xpp0~? S U 0 # !1" 0SK q_&^0A0C,ĠCCCC R/ G-p0HM008 4Q 0Q <0 @R 8ȟ0 p 0%00#0 <8 $! a@  $ , ǁ  #  " 4b% 0!00#p0<, ! pa " ,$pǁ #  "(p b% 0!00#,p0<, !0a4p)NON " ,Pǁ #  " 4b% .!4 ğ ". xğn  #, \ğ$ 0!0# 0@ğc> .!$ $ğ ",0ğn  #,<#Ď  0! 0#0#c>  . " *,! a #,,|ā0" 0#0dc> !. H*,!0a #,ā0 .$0c=  *  b+) ) Ł (00c=  "0 \b+ (@  ,(Ł0 (p0c=p p'  pb+ ppp'0P3 : L?0V FKh >@P 0-@PLMK " !? 7R8 bx b8K  X K0h: &^0@-@$0`( "$`T"a! 4a# 0 -P`8 `#T0.p@L`T%0 (0D PD 0Dd0P00DD0D`V@@p@%TH́-M Ѝp@-@ P` !LN( !@Ap RC/A 0\R#R! R/ -`LpP@# * PP @  R_@P 0@P0W H0W V@`V`T@yaratcid -LM0p14a@[ 0P 0P V`:P@ ` 0*K.P0! *`PP !``P 0(ԞK$yaratcid p-LM@@@P@`T:Kp0 0` 0  Xt_ t_P0 vyara0 L'0 mtcid0 L'Qd/yara00L'QY/tcid00L' / z/ 0-L@PP0 0PP0tcid 0-L@P 0Pt00loob -PL`X@PP  P  0-LP@ X0P 0 P P/ 06 QPrbmn 0-LP@ X0P 0 P  P 0 P0rbmn -PL` @PP  P  -PL` @PP  P  0-LP\@: `0P 0 P P 0 0 QPrbmn 0-LP9@ X0P 0v P u P 0 P0rbmn -PL`4 @PP  ;Pa  -PL`, @PP  'PM  0-LP@ `0P 0. P- P\ 0c 0!QPrbmn 0-LP@ X0P 0 P  PF 05 P0rbmn -PL` @PP  P  -PL` @PP  P  0-LP@e X0P 0 P @P 0 P0rbmn 0-LPg@E X0P 0 P  @P 0 P0rbmn -PL`b @PP  iP  -PL`Z @PP  UP{  0-L@P $0P00gnts -PL` @PP  /PU  0-L@P $0P00gnts -PL`@PP   P/  0-PRL@ @# 0!P0/&^0^0@-PäP P P P0tt@L\PDT\\ \ \00P0\:$$ P000\0SNP0T0NUT:xx0S0 -`LDM @PU0<0 00<0 0 S S S|=x=@0 0SJ  @ cPP@= Y0J"@ @0 pU0pSpW8U &K080 <0 ` P40 Hp Dp <00SL0 j <0000 <0 L0=S *S :S| 0 0S0  <`L̠   S3"P% R0@0CPE08`p S>03P05@2 U *00J  @ Ec@PP U< 3 @ 5@2W0  4P<PQ0<0 8  U8 4505@2 X,p4 <` <\40<S P U>0305@20 0RP0(K Q* DQ'R0@0CPE08`pp S>03P05@2 U * 0 @ J40 b40@WP @ P U50@2`P U50@2` P< 04 < 4 0A P0p 8p  D L0bSR fS FS@<0000 <01 A a>0 3P 5@2 U *0`0J  @ vb@PP U< 3 @ 5@2W` b 0B0"!0# 0 00V 3 "R' X @pH0`FD0PE00 0 S>03P05@2 U *0`0J  @ =b@PP U<03 @05@2W` y4 P<R00SH00< H0 D00 UD0 405`05@2 00 0C40 00000 0Sp,040 X R+ 4 R(XH @`FD PEp0  p R> 3P 5@2 U *<0 0`0@ J @ a<0WP @P U05`@20 P U05`@2408 P<S  RH00< H0 D00 UD0 405`05@2L0FS 00 B< 8,0p40 0 0S0 80 00<0 ( 0S: <0S7XH0@`FD0PEp00 0p S>03P05@2 U *0`0J  @ a@WP @'P U405`05@2000 0 S0 40  0S P U=03`05@20P U405`05@2 00CSXH0@`FD0PEp00 0p S>03P05@2 U *0`0J  @ Oa@WP @P U=0305`@2&KJ @ =aP80 P U`@0V00S3 0BV):XH0@`FD0PEp00 0p S>03P05@2 U *0`0J  @ a@WP @P U`8p %#038p 505@2,040 P U#03050`@280 d0RL0=S. 0S8 0CS5X @pH0`FD0PE00 0 S>03P05@2 U *0`0J  @ `@W<0P @ `40 P U=03`05@2 00 B< 0 0 S0 80 0P U=03`05p@2 0S+ <0S(X @pH0`FD0PE00 0 S>03P05@2 U *0`0J  @ `@WP @*P U805`05@2p00P U805`05@2<0000 80S&KJ 0 n`P0P U`@080 0 `80 <0Z8p ` PIL0FS080 $q_61_^ 00-LM@0@zK0/ -P`L@ aP -p-PL`@ aPKp 0-PL@ D`P0 -p-PL`@ `PKp -`pL@P `P -p-PL`@ `PKp00/P'0-P@  P 0S RP0/P*0    PP0/0/R  0\/S/ --LM 00S 3_ Kp@-@ / ?!BC  @ 0-,LR@P 00 000`́d'^ 0-@L0P /T0`́ P-L 0R ,0QPo0^ 0- 0PSL@HK0h P -P K0h0r_ -Lp@P 2P9`P-@>` P 0-LP@P P0 000 -PPL@ l0Rp@P 0000`P0Q`d'^0^ -PPL@ T0RH@P  `P0Q`d'^0^P/ 0R /d'^P/ 0R/d'^ 0-@PLP0 40R ⯖PP 0Qd'^0^P/ 0R0P//d'^0^ -L M@P` K?o 2Q0S0S P 0PpxP  D0R S0 ( g^ PP d'^0^4^ -L M@P K x0R`B PPpG`P 08 S0( 9^ P`P Wd'^0^4^0P- ?o, 2^0S0Sd'^ P-L ,0R 0Pod'^0^ -LM$0pSP ``V`$0K P $@P 00$  0KP 0$ S K` (P 3P$0@ 0r_ 0S/-S0-S0>S/00// 0-P0L@Q ЕP00< 0 P0 0-PL@AQ0P0 -@`PL 0S<P P >Kh PP 0-LP<@P /P P >P K0h0 -@`PL 0S<P P /P >}P Khv sPP -@l`lpLPAQ<Q >Q &Q 8pPOr_r_r_ D0-L@^P ,hP K0h90'^#r_ (0-L@wP0K0h(Fr_ 0-L֔@P  єPP0@0,0 0 -pQL@P b0 @ R6" <P0 R !R -R E/o"-Q R00P/R>PEU0S0(0 ` P 0B0S<300>R/R)0FW0 S P0/S0P$0(0S0$00>S0 >S0 000 0P(PR`0S  0@0S<3 P   0@0S>300=P00S A 0"Ss0 S 0m "P  C  >Rd00P ]P0Y0@- PP0<P8 &P @aT@mT!@pT2@;T/Q ^**lT'tP";P<tP;P>pToPsP ;P'SU00gT qTuPoPtP;P" Q-L o p-LIM@IK``P R PK?KPJ/KMKIKxP Kp0 P  PP,1 MKIK(Q5/04a  MKIK3/P4101  `K?KJ/KKIKTP0 41 0K,1IK(Q5/P 0141 ((^ -L@,JPP7 `p@@ 0B0S 23 YP&@<R P  P0>SSS DP@@HP @@7r_=r_Lr_) -LM0 IK0a00S 3/@0P P U 5/0K0 IKPK0KIK03/U` 5/V  V Vp01(1 (Q00S 3/`0@ P T 4/003/0JK03/P T 4/h p -LPY@PP PP$0SP 0` P P PP  `PxPFr_8 _P0/ -PLJM8 IK< =U0`0~K8100 00RP P xP %P PP 0  03/P P Pt8^(^rr_ 0-@P@Ld 0 0 0K0h -@PL 0R@ pJ`PP@ 0兑ᅡ   0兡 0P 00U:000(^ 0P-L $0R00P   (^ 0-@PL000K0hb 0-@PL ,0R@P@Q0(^ -@PL` H0R@ P0S@#*W@5(^ 0-@PLT $0R@@0(^ -PPL x0R|@`0S pW`@ 0VpP `(^ -@PL` <0R@ P @(^ P /o00"\ R00\~/(^ -LM@Pp 2R0 Z0 K)PP @ p P-(0S @Ėi`P 0Q>PP9 `,V <V VP w(KGPP h `<卖42`P ǖ1v`徖V P U` 0080 < P80S0C00 ! 8 0` 0p0000000  E@"B!# 00 0a 00 1 pP(^\'H[HρLρ`ρPЁ@с(^ -L@TP`p ᎌTb00 1P V0 $Kk)M0P- ?o42 ^0S00 S(^ -LM@P`) 0R%Pm0 K9P 0 p`  C! 00C0000 K(^0P/?o( 2\0S/00 S/(^0P- ?o, 2^0S0S(^P/ 0R/(^0P- ?o, 2^0S0S(^ P-L`Pp@ @T P*  0 S @EC  S@ 000 0  00 0 0P @ 0-LP@PP P坋P00 03/P P P -0LpS@P =`P $Q`T0PH `Kht8^ 0-,L=F@P 00 0000ҁD)^ P-L 0RR o 0-@L0P 3G00ҁ - 0@SLPp,KosPS  `LVV)0,Ko 0"!0 @Yq#1 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/ R.0 \ B BѴ Bôr- B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@@t@P B@@P B@@P R@/ R/ R Ѥ ä/-\{F ,DP`pL%T\&dl't |@P`p B RR,DP`pL%T\&dl't |@P`p R/ RAn,D R L@Af,HP`pH%XX&hh'x x@P`p B RR,HP`pH%XX&hh'x x@P`p R/ RA:,H R H@A2,LP`pD%\T&ld'| t@P`p B RR,LP`pD%\T&ld'| t@P`p R/ RA,L R D@A /R Ѥ ä// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/011/ -pL@Q`P xP `P10r 0 P 0-L@\& ^ QRS  T00x0LQ R S "  T  00 0 -LMQ@P`pW Z ' 0yZP@ R[WPZ @0G Z 0 @g@Oo@d8D o?oL\Z 0  l>4L4 00 5 N04P? ᮏ0<0 080 奟PK /#K R 0\@4P 0 #K 0 Z@P(KW30B Z00 V f`oo`f56 f0F00 140 #K@Po?oA! \4p  \ @l4>4p 00 5 D@l0@>40 000 5Do?oL\ 0 \#K0@ @ l14L00 5 AQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /~-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ -L>r_ 04 8 < S $S $S /T S $SQ 0/Q 00///PP 04 8 < S $S $S /h S $S $S//Q 00/Q 0// 0-PPL P 0S 8@P Y8K0h؝@0M/ \∼1M/ ₼ 0<P   /  W XPP PAPEU PAPEU0L \ P 0A0CS00L-\ Sʛ@ALX0 0PEPR.\p QR0 B  h\ -`p@LM |PK.Kt! .L`Ko! .k!`0K :KĶ^ -LMPOK( pwK{`PV T60S H60S 0I2 0Y0K?K"ᤝP ,1" Qp:pWE) )wKg(K K{K  Kw P wP 2[S 2[0S 850S  .kK %k?K#;0S 40S  .kK 0$0k?K;DwK&(C "`pb(4]Kx |1 _Kd CPP1 0 R 0S 840S ?K{/KKK:$0 :,  P 30S .kK ?K{/KKKk?K#:30S ?K KKh#0x1[S @30S ?K{/KKK #041[{K_KS1[000C?o 2  2 xP 20S 20S{ 0 KK"0]2_/K((CR_KRP`20S 0 KK@"0\l:wKCt!R 0 ⃡ 90 00 S 10SG  .kK( 0 KK9p0J0pk?K!E:3200000 0XwKQ2SB 0tat2 P{id1b 0SSD{!roKkK C ?JK @:0KKiK000KIK!>K00 jP 2 3?xT{H0IK( ,1 {?KKK .$^H؜n]_^^^7^^Ÿ^^J^o^\@+ܛG -L4M%,22,2ei$Al<+h!H%t4G'{뚫N]4OZ _+Āc _'U _ Łʚ;>@J_O _ _W _I p-L M80@S` 0 00V`yoPP  Kp roPP ,1000` +0`0`400 R8PS"0P@_ #_0^ $_#_ 0-LMP K@P0000-K0 -LM 0p0P@ H`(100尔00300 020(0K00 ۝`P5(0S oP7`+ B@0 0ŝ400'$'$(%(%)&&#&#%")#K0 #K88 RЀ0 0 0$KKJ@J@0A @0H@P`@p @p@@zssp_initzssp_ic_startzssp_ic_stopzssp_read_max1111zssp_read_ads7846A@A@B@ B@8B@PB@hB@B@ioexp_set_backlight ["$&'X4gklr'/57<?BCEGHIJKLMNORUVWZ[\^_:;<=>?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_[\[ m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    d@e@hf@f@g@$Rg@`Sg@$Rlsllsrasrror 4^4^4^0^4^0^5^0^@ 5^5^P5^5^`5^0^_M5^5^P %5^)5^-5^^@ 15^65^P 95^65^>5^C5^ G5^C5^K5^C5^ P5^C5^T5^Y5^\5^Y5^`5^e5^h5^e5^l5^e5^q5^e5^pPu5^z5^5^5^p5^5^pP5^z5^Q-^W^Q-^W^p 5^5^p 05^5^p `5^5^p p5^5^P _5^P 5^5^P @5^5^P P5^5^- _5^5^5^ 5^5^5^5^5^5^5^5^ ^^ 5^^5^4^5^4^5^4^0 5^o^005^o^005^o^005^o^6^o^6^o^ 6^o^6^o^6^o^6^o^ !6^0^ %6^0^ +6^0^ /6^0^ 36^0^ 76^;6^>6^]5^>6^4^ B6^F6^ B6^J6^/N6^#5^oQ6^5^0/-5^#5^p U6^Ŋ^Z6^_6^@b6^_6^g6^k6^@o6^k6^t6^d^z6^d^6^d^6^d^6^6^6^6^6^6^6^6^ ײ^6^ 7^6^ @ 8^6^ `6^6^ N_6^ 6^6^ 6^6^ 6^6^ 8^6^ 06^6^ P̏^6^ p6^6^ 7^6^ 6^6^ ݵ^6^ 6^6^^^6^ 6^6^6^6^6^6^6^6^6^6^7^7^7^7^ 7^7^07^7^@7^7^P7^7^`"7^7^p&7^7^*7^7^.7^7^27^7^67^7^:7^7^>7^7^D7^H7^M7^H7^ Q7^H7^0U7^H7^@Y7^H7^P5_H7^`]7^H7^p2_H7^a7^H7^e7^H7^i7^H7^m7^H7^q7^H7^u7^H7^y7^H7^ 7^7^ 7^7^^7^7^7^ 7^<6^0Z_<6^@7^<6^P7^<6^7^7^"^7^7^7^7^7^7^7^7^7^ 7^7^07^7^7^7^7^7^ 7^7^07^7^7^7^7^7^7^7^7^7^7^7^8^7^ 8^7^eqnecsccmiplvsvchilsgeltgtlenv0.01.02.03.04.05.00.510.0edeafdfafafdeaeddaiadbibpmzsdep0^0^4^4^0^0^4^4^0^0^4^4^0^0^l^b^q@q@إT_bus_dma_busaddr_to_paddr ?^.?^.?^9?^G?^U?^h?^}?^?^?^?^?^.?^?^?^?^P_@^@^@^@^-@^)@^6@^2@^?@^;@^H@^D@^U@^Q@^Z@^c@^k@^u@^k@^~@^@^@^@^@^@^@^@^@^@^@^@^@^@^@^@^VA@^[2PVA"@^[2VA-@^[2AVAA^[3VAA^[3 VAA^[3pAA^[3qAA^[3qA#A^[3qA+A^[3qA3A^[3A=A^[4D DA^D[4D KA^[4i SA^[4`Rf[A^[4 i aA^[4qAiA^[4TrAqA^[4TtAyA^[4TtAA^[4TAA^[4T AA^[4TAA^[4TPTA^[4T`A A^[5TE`A A^[5TE`A A^[5TE%V A^[5TEWV A^[5TE iA^D[5TE $iB^[5TE0$iB^[5TE ,iB^[5TE0,iB^[5TE .iB^[5TE0.i,B^[5TEAi:B^[5TE!iAB^[5TE !iHB^[5TE)iAB^[5TE )iHB^[5TE-iOB^D[5TE -iHB^[5TEAiZB^[5TEAihB^[5TEAivB^[5TEA B^[5TE A B^[5TE`A B^[5TEJ`A B^[5TEJ`AB^[6J`AB^[6J`AB^[6ZK AB^[6KPAB^[7ApAB^[7AAC^[7A/AC^[7A?AC^[7AA(C^[7A/A5C^[7A?ABC^[7AOAOC^[7A/A\C^[7A?AjC^[7AOAxC^[7AAC^[7A@AC^[8A0AC^[8ApAC^[8ApAC^[8AAC^[8AXVC^[`AC^[XVC^[?AC^[@XVC^[ AC^[@X/VC^[C^D^D^ D^D^D^D^%D^+D^1D^7D^>D^ED^LD^SD^ZD^aD^jD^sD^|D^D^D^D^%D^+D^1D^7D^>D^ED^LD^SD^ZD^D^D^D^aD^D^sD^aD^%D^+D^1D^7D^>D^ED^LD^SD^ZD^aD^jD^sD^|D^D^D^D^%D^+D^1D^7D^>D^ED^LD^SD^ZD^aD^D^D^ D^D^D^D^%D^+D^1D^7D^>D^ED^LD^SD^ZD^aD^sD^D^ D^D^D^D^%D^+D^1D^7D^>D^ED^LD^SD^ZD^aD^jD^sD^D^D^D^D^%D^+D^1D^7D^>D^ED^LD^SD^ZD^D^D^D^D^D^D^E^E^+D^1D^7D^>D^ED^LD^SD^ZD^aD^D^D^ D^sD^|D^D^"E^+E^4E^7D^>D^ED^LD^SD^ZD^D^=E^DE^ D^D^D^D^%D^KE^RE^YE^ED^LD^SD^ZD^D^fE^mE^tE^{E^D^D^%D^+D^1D^7D^>D^ED^LD^SD^ZD^E^E^E^E^E^E^E^E^E^E^E^E^E^E^E^E^D^D^D^ D^D^D^D^%D^+D^1D^7D^>D^ED^LD^SD^ZD^@H^@H^@H^@H^l@H^I^l@,I^II^l@_I^I^l@I^I^l@I^I^l@I^J^data_abort_handlerbadaddr_read@````` ```pmap_map_chunkȉERROR TIMEOU DFPdAcAPcAhAmA[AT[APdAcA^A^AhA$RlU`S QT[AS^T^S^S^S^S^S^/T^]S^tS^S^S^S^S^S^S^CT^OT^ZT^dqA$qAnAnAXzAmATCC\C(AmAmApAatastartata_thread_runatabus_threadЏAДA$R$RA$RlU`S Q$R #(-27<FP d'SpectecSDIO WLAN CardSDW-820e @ d' #(-27<FPsdmmc_mem_enableb^ab^P.b^4b^ ,;b^@P 5B{^G{^Q{^^{^b{^z{^{^VVwhJx^{^Jx^{^{^{^x^{^x^{^{^Q{^|^ |^P8soo P q q sMkltG{^Q{^tt3&|^-|^ hCK|^^|^ h&FILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54 ~ `c܀ `d`~d`d `#x`d$Ega#Xd@Pa"*2:BJRZbhpz``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`xih^d@@d@A@B@T@U@^@Z@[`b`4dЀ `bU`dЀ`Pb`.d`RbƂ `Pbd`Rcd a`c`>a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~BBBB`BBBBBPBBB$RlU`S QB5|Bjd^`}^sysctl_wiwi_push_packetwi_write_txratewi_startwi_rx_intrwi_rssadapt_inputwi_tx_intrwi_tx_ex_intrc^^^^ʂ^^^E^m^^ ^ E^ ^ ^ ^ރ^ރ^ރ^^^^&^&^!D^"D^THIS is A memory TEST pattern !)PCC>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IXkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWccƄ||ww{{ kkֱooTőP00`gg}++Vb׵櫫MvvEʏ@ɉ}}YYGG 쭭AgԳ_꯯E#Srr[·uᮓ=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07 / 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:RRRR jjjj000066668888@@@@||||9999////4444CCCCDDDDTTTT{{{{2222####====LLLL BBBBNNNN....ffff(((($$$$vvvv[[[[IIIImmmm%%%%rrrrddddhhhhԤ\\\\]]]]eeeellllppppHHHHPPPP^^^^FFFFWWWWث XXXXEEEE,,,,????kkkk::::AAAAOOOOggggꗗ𴴴sssstttt""""筭55557777uuuunnnnGGGGqqqq))))ʼnoooobbbbVVVV>>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;QT]S]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽHT]T]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTHT]T]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@T]S]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_r/_@[ ,Κ;qLr!oADSgEmV1JBچ8{ Bieee80211_setmode@P ,    $ 0H`l     $ 0H`lieee80211_media_status , $0H`lieee80211_media_change   $0H`l  $0H`l_ieee80211_crypto_delkeyieee80211_crypto_registerieee80211_crypto_unregisterieee80211_crypto_newkey^^^Ə^Џ^ieee80211_crypto_setkeyieee80211_crypto_encapieee80211_hdrsizeieee80211_crypto_decapieee80211_hdrsizeccmp_setkey^-D-Dp-D)D4.D'D2Dڐ^2D2D2DT3D2D2D2DƄ ֱTP`}VbME@Ɏ Ag_E#S[u=jLZlA~O\hQ4sSb?* ReF^(07 / 6$=&iNtX.4-6[Mva}{R>q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-tkip_encaptkip_setkeytkip_decap^4@D,@D$=D\;D=DED(DD0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ieee80211_hdrsize^`LDXLDED|KDHHDEDLDieee80211_hdrsize ieee80211_sysctl_treetopieee80211_sysctl_setupieee80211_sysctl_attachieee80211_load_module_ieee80211_free_nodenode_reclaimieee80211_free_allnodes_lockedieee80211_node_table_cleanupieee80211_reset_scan_ieee80211_find_nodeieee80211_setup_nodeieee80211_cancel_scanieee80211_get_rateieee80211_tmp_nodeieee80211_find_rxnode_withkeyieee80211_find_txnodeieee80211_find_node_with_channelieee80211_find_node_with_ssidieee80211_free_nodeieee80211_create_ibssieee80211_ibss_mergeieee80211_end_scanieee80211_next_scanieee80211_node_delucastkeyieee80211_iterate_nodesieee80211_node_leave_11gieee80211_timeout_stationsieee80211_node_join_11gieee80211_node_table_resetieee80211_node_lateattachieee80211_node_table_initPieee80211_encapieee80211_compute_durationPPPPPPPPieee80211_send_probereqieee80211_send_mgmtieee80211_mgmt_outputieee80211_beacon_allocieee80211_beacon_updateS^S^S^S^a^S^a^ieee80211_newstate  0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked       ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparamsieee80211_rssadapt_sysctl_setupƯ^EFE4FCEEEl]hEmGEEhn]8jGkFE|ELm]PF|FF|8FEEl]CZEEl]LZ)CZEEl]LZsCZEEl]LZC|eEEEl]cE\nE,oEC|8FEEl] >F}E#(D(@AAA==A*ip_output7F7Fd8F=F6F?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!^^^^^^^^^^^^^ ^3^9^^^^%^^^^^^^^^^^^^^^wsevent_copyout_events(JJJ|JHJ$RJ$R̥J`S(J$RABCDEFGHIJKLMNOPQRSTUVWXYZJJJ$RJ$R????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?h&&&]]o]#]                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~T]]a])h]2]Ý]ĝ]ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~PX0,K/KTF,K,KPND+KRR*KCE*KST*KNM\.K1KCL,K0PL,K0REt*K@RR*KCE*KST*KSL2KRR*KCE*KST*KER4KCE*KST*KxX]]]5?K^DĠ]]xHWX]AXt]AX]AX]AX]AX]pSK]PK]$KK8]AXT]AXp]AX]AX]X]AX]AX]AX]AX4]AXP]AXl]AX]AX]AX]AX]AX]AX]AX0]AXL]AXh]AX]D%K]p%K]`X]X]AX]AX,]PSKH]ȷXd]AX]AX<]HW]AXH$]]xHWX]Xt]̵X]̵X]X]XX]pSK]PK]$KK8]XT]DXp]X]XX]X]X](X]X]жX4]XP],Xl]X]̵X]̵X]̵X]̵X]̵X]̵X0]̵XL]̵Xh]̵X]D%K]p%K]`X]X]X]X,]PSKH]ȷXd](X]X<]HW]~X]XL]]xHWX]Kt]X]X]X]X]pSK]PK]$KK8]8LKT]Xp]X]X]X]ȶX]X]жX4] XP]Xl]X]X]@RK]X]X]X]`RK0]VKL]NKh]X]D%K]p%K]`X]X]K]RK,]PSKH]ȷXd] TK]X<]HW]~X]X???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥDhKhKxXgKXgKXupdatefatsUx]5K^. .. ]]xHWX]̈Kt]K]X]X]K]K]$K] K8]ĵKT]dKp]X]X]X]ȶX]X]X]жX4] XP]Kl]X]hK]X]K]?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z<7L,4L<7LP8Lnfs_sillyworkerH;Lh;LL]?L]`X]8L]AX]̵X,]LH]ȷXd]AX]AX<]̵X]AX%]]xHWX]Xt]̵X]̵X]X]L]lL]L]L8]xLT]кLp]X]XX]X]X](X]X]жX4]XP],Xl]X]̵X]̵X]̵X]̵X]̵X]̵X0]̵XL]̵Xh]̵X]>L]?L]`X]8L]X]X,]LH]ȷXd](X]X<]HW]~X]X %]]xHWX]Lt]lTM] TM]L]HM]HL]L]L8]pLT]pKp]X]X]X]ȶX]X]9L]жX4] XP]Ml]X]hM]ػL]M]M]L]DkM0]LL]Lh]X]>L]?L]`X]8L]L]L,]LH]ȷXd] L]L<]̵X]K]Xffs_mapsearchffs_nodealloccgffs_blkfree_commonffs_freefile_commonffs_blkallocffs_blkfreeffs_realloccgffs_blkfree_snapffs_freefileffs_freefile_snap]]]]        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?(|NNXNXffs_newvnodeffs_reloaddN NNlM0!NqN8vN ffs_sync]]x]5BNp^^$%]]xHWX]AXt]AX]AX]AX]N]N]N]$N8]HNT]|Np]AX]AX]AX]X]AX]AX]AX4]AXP]yNl]AX]AX]AX]AX]AX]AX]AX0]AXL]AXh]AX]N]xpN]`X]X]AX]AX,]|NH]ȷXd]AX]AX<]HW]AXD]gN]tqN ]|qN|]qN(]dqN`]lqN(%]]xHWX]Xt]̵X]̵X]X]N]N]N]$N8]XNT]Np]X]XX]X]X](X]X]жX4]XP]>@@ @@ rw_vector_entercrashme_sysctl_forwardercrashme_removeAD 0  pid %d (%s), uid %d: exited on signal %d (core not dumped, err = %d) pid %d (%s), uid %d: exited on signal %d (core dumped) zR`zR zR\sysctl_lookup*_*_ *_*__config_devdeleteconfig_finalize_mountroot0^"_!._device_pmf_driver_deregisterdevice_pmf_lock1device_pmf_unlockSxSSSbdevsw_attachcdevsw_attachopendiskp4_w4_4_ 4_(4_04_84_@4_P4_`4_p4_4_4_4_4_4_@4_4_5_5_5_"5_G4_Q4_ [4_@e4_XLTKTLTLTNT$ROT$RMT`S,OT$Rpr_phinpage_checkpr_rmpagepool_initpr_item_linkedlist_getpool_do_putpr_item_bitmap_indexpr_item_bitmap_put0123456789ABCDEF0123456789abcdef|/-\TTvmem_rehash_startHTUx UUUpUU U5T U<_L>UH1U6Uh9U9U8UDU@UDUAUh=_PP PPl0U/Up6UP P542U =_X=_UHUhUPȋUUЋUVU@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@UUTU̎Uttyoutttyinttybgttyopnttycls,?_4?_9?_@?_E?_I?_O?_ X_] 2X_] &X_ ] X_]  X_]X_] W_]!W_]"W_]#W_]$W_]%W_]&W_]'W_](W_])W_]*W_]+sW_],bW_] -SW_].CW_|]/3W_t]0!W_l]1W_d]]<]X]t]]]]]]]8]T]p]]]]]]]4]P]l]]]]]]]0]L]h]]]]]]],]H]d]]]]]] ](]D]`]|]N_(]Ł0]]lX<]HWX]kX]$kX]X8],kXT]DkXp]X]X]X]LkX]TkX]lkX]lX]kX]kXP]Xl]X]\kX]X]X]@X]lX]lX,]0lXH]ȷX]X]plX]PlX$pXoX,oXpnXŁH]]xHWX]lXt]̵X]̵X]rX]DvX]X]X]X8]qXT],qXp]X]X]pX]XwX]mX]жX4]̵XP]Xl]̵X]̵X]̵X]̵X]̵X]̵X]̵X0]̵XL]̵Xh]̵X]lX]X]`X]X]lX]̵X,]uXH]ȷXd] mX]X<]X](Xgenfs_suspendctlXXXXXXX5XZ_layer_bypassƁ]]xHWX]Xt]̵X]̵X]X]XX]X]X]X8]XT]DXp]X]XX]X]X](X]X]жX4]XP],Xl]X]̵X]̵X]̵X]̵X]̵X]̵X0]̵XL]̵Xh]̵X]X]X]X]X]X]X,]XH]Xd](X]X<]HW]~X]Xdevclsdeviocdevoutdevindevwaitdeviodevopn5X`}^dkdumpYH YYXlXXXYH YYYX$RlU`S QX}^_ __^___EFI PART(s*K>;^2IчH!_|nQn- q+!_ZIчHp^|nQn- q+p^SFU0eCp^IчHq_IчH[_-чH[`_-чH[_SFH0eC__S'@ )Ѹ_`_*1@ )Ѹg`_1x )Ѹl`_3Dh&t`_=rGy=iG}y`_P*YX)Yd/Y.Y$-Y$RlU`S Q$RP*YX)Y((Y$-Y$R\&Y$RX0YPRd1Yd1Yt0Y$RlU0Y Q$Rl5Y$R$R$R$R$RlU`S Q$RU7^8Yl7YL5YP$7Y4Yl4Y6Y PLYp=YXYl;Y P_bpf_mtap_softint_init5JY`_~a_5dY~a_ifaddrpref_ioctld n;0&AvQkkXaM* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jrt_initrt_timer_initmZV%[Ag%=C+ˮ{0w-0 jB;rt_deladdrroute_outputrt_msg1route_enqueuert_addrmsg0 ZdBZ]?ZIZXIZGZGZ@Z@ZHZIZHZlGZ@Z@ZAZAZ@Z@ZHZ@ZTGZarpannouncearp_dad_startarp_dad_timerarp_rtrequestarpresolvePxiZqZ gZin4_cksumwqinput_createwqinput_sysctl_setup5DZj_5`Z{k_5Zm_5Zm_m_ cP$:Y0YdYDYDUJ/^]jd^]6^]m^]^]^]^]^]f^]^]i^]^]^]^]M^x]5^p] _h]uo_\]o_T]X^L]o_D](^<]3^4]' _,]_-^$]?c^]"f^]e^ ]e^]i^]k^]o_]pl^]p_]-^]0^]0^]81^]1^]K2^]lp^]{2^]z^]dPā ؓtHЂĎ0ؔ0h<`4ܝX$?c^?c^ p_p_f^X^X^^o_z^z^k^o_0^0^p_81^%p_K2^r2^{2^/^-^3^3^"f^"f^(''&&&&h&H&(&&%%%%h%H%(%%$$$$h$H$($$####h#H#(##""""h"H"(""!!D^\^^^4^l^^^0^^H^^p^]X^^]^^uo_X^.p_pD^/^J_pD^^4p_pD^jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGq_!_q_q_ __q_q_p^^q_q_q_^_q___q_y`_t`_[_[`_q_^q_q_q_q_q_[_q__`_g`_l`_0^gnts*[8+[*[`́ r_ ?^r[Qr_ f[Vr_ f[^b[t8^ [[\r_F[r_0[A[A[rbmn@[DC[A[p@[@[h́(ir_tcidJ[J[ N[Y[I[tH[hH[H[H[ yekdJ[hM[G[X΁ vr_@сr_PЁ<r_`ρ,r_atadL\[\[[[ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/0ҁr_loobLd[d[e[yarah[`f[j[xg[Pg[8Ӂ r_strtoullstrtollstrtoulCopyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018, 2019, 2020, 2021, 2022, 2023, 2024, 2025 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. INSTALL_C700src:20251226125458-xsrc:20251218184212 NetBSD 9.4_STABLE (INSTALL_C700) #0: Fri Dec 26 12:54:58 UTC 2025 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700 @(#)NetBSD 9.4_STABLE (INSTALL_C700) #0: Fri Dec 26 12:54:58 UTC 2025 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700 9.4_STABLENetBSDmd%d: internal %s image area match_bootdisk: can't get label for dev %s (%d) no mainbus foundwdWARNING: double match for boot device (%s, %s) boot device: %s ziici2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failediso partitionbad sector table I/O errorbad sector table corrupted: I2C controller unable to attach PXA I2C controller i2cbuspxaiic: PCMCIA/GPIO controller %s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_set_power: bogus power statescoop_pcic_write: bogus registerpxapcic_scoop%s: not configured. can't map bus space couldn't establish power handler zssp%s: not configured zssp: zssp_ic_send: invalid IC %d Sharp Zaurus frame bufferSharp Zaurus LCDw100lcdstd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) unable to create new screen (errno=%d)lcdctl%s: this kernel is not support SL-C1000 couldn't register event handler zkbd: pseudo power management module apmdevifzapmunable to establish nSD_DETECT interrupt unable to attach MMC controller %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference   base 0x%x-0x%x irq %d drq 0x%08x core %dmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbuslr, rrx, %s r%d, %s #%dthumb insn %s%s , #%d#%d ; #0x%x[r%d][r%d#0x%03x#%s0x%02x%sr%d{r%d-r%d}^f%d.%c%d, #0x%04xspsrcpsrp%df%d, c%d, c%d, c%d, c%dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown]und%s %08x oshstoshnshstnshishstishcpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxstrtdaWldrtstrbtldrbtldrstrbldrbpopstmYnWlldmXnWlblimbimbrangeswistrhtldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsmsrpFmpF2bxclzbkptmovwdZmovtswpdmoswpbldrexldrexdldrexbldrexhstrexdmastrexdstrexbstrexhSdn2adcsbcrscDn2teqcmnmovSd2mvnSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnsincostanasnacsatnfpuopstfQLvldfPRgdfixPRdhwfswfcrfccmfPRghcmfecnfevandvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddvtstvsubNo support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() single-skdb-k-dask-aquiet-q-v-x%s: curaddr %#lx not in range_bus_dmamap_sync: mix PRE and POST_bus_dmamap_sync: _BUS_DMA_BUFTYPE_INVALID_bus_dmamap_sync: map %p: unknown buffer type %d _bus_dmamem_map: size botch%dKB/%dB %d-way %s L%u %cI%cT Unified cache %dKB/%dB %d-way L%u %cI%cT Instruction cache %dKB/%dB %d-way %s L%u %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x Processor failed probe - no CPU ID %s%s%s (%s V%s core)unknown CPU (ID = 0x%x): %s %s %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-SARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step A-0step A-1step B-0step B-1step C-0rev 0step B-2step D-0(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step B-3step B-4step B-5step Bstep Cstep Dstep Erev 10step Gstep Jstep Kstep Sstep T*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap %s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)kmpagespmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %ppmap_pv_protect: page not pv-tracked: 0x%lxfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table provided%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)standby immediate standby immediate not supported wd_standby: status=%s %s: (error not notifieddevice faultdevice timeoutrequeuechannel reset, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramswd_setcache: status=%s wddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %xIDENTIFY failed SPLIT_MOD15_WRITEFORCE_LBA48quirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jdWARNING: block size %u might not actually work hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d wd_trim: status=%s wdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed wd_flushcache: status=%s address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015AS%s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq recalpiomodesetmultiatacmd_to48: illegal 32-bit command: %d%s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: not ready, st=0x%02x, err=0x%02x %s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferatabus at %s channel %dwd at %s drive %d%s: unknown child %patasplatainitqcan't alloc drive array %s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout %s: unknown type: %xunable to create kernel thread: error %d %scnfunable to create config thread: error %d %s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported atapibus at %s not configured ata_hlatabusatdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer errorcouldn't create task thread "%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x%sat %s function %dcouldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE setsdmmc_select_card: SMC_CAPS_SPI_MODE setsdmmc_select_card: error %dcouldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed bad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short MAX_BLK_SIZE%d = %d bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: extended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz switch error error waiting for data ready after switch command: %d can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d unknown SD CSD structure version 0x%x unknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x %s: %s failed with error %d SD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) SD card status: unknown bus width %d-bit, C%d, U%d, V%d, A%dcan't execute SD tuning can't get SD status: %d write-protected Default/SDR12High-Speed/SDR25SDR50SDR104DDR50: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s,blkno 0x%llu exceeds capacity %d , retrying ld_sdmmcconfig_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_hook: malloc failedconfig_connect: malloc failedconfig_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270Kernel is configured for %s, but CPU is %s : Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxaippxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented stray interrupt %d : Interrupt Controller intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %d: can't map registers pxauart%s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostStray DMAC interrupt for unallocated channel %d : DMA Controller dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedpxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmacpxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicss: %d slot%s can't attach failed to map MEMCTL pcmciabusunable to map register %s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer couldn't attach bus apmsuspendpower management disabledreal mode interface already connectedinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentunknown error codeAPM reservedAPM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %sPower Management spec V%d.%dunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedapmdevpcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! Cannot allocate cfe entry CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for pcmcia_check_cis_quirks: malloc pfpcmcia_check_cis_quirks: malloc cfeSVECFD605 PCMCIA EtherNet CardNDCPCMCIA MBH10302can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-Ethernet1.0DYNALINKL10Cne_pcmciacouldn't establish interrupt MEGAHERTZMODEM XJ2288com_pcmciacan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmciawiinitcouldn't load firmware failed to attach controller SMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC CardWireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciavendor %4.4xproduct %4.4xunable to flush cache timeout draining buffers failed to flush cache i/o blocked while suspended lddrain%s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors %s: not drained dk_subrLucent/Prism/Symbol 802.11 controls%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x detect auto increment bug, try again wi_cmd: busy bit won't clear. xmit failed %s: %d tx cmds pending!!! record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d %s: cleaning outstanding rssadapt descriptor for %s %s: tx rate %d -> %d (%d) %s write fid %x failed %s read fid %x failed %s: null node%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%xwi_scan_result: unknown firmware type %u failed to allocate %d bytes on NIC tx buffer allocation failed timeout in alloc %s: interface not running %s: device timeout LucentSymbol could not establish softint could not get mac address, attach failed 802.11 address %s %s: using Unknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list if_initialize failed(%d) Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration dp8390_start: no header mbufEthernet address %s %s: NIC memory corrupt - invalid packet length %d device enable failed ne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete where did the card go? setup failed %s: %d silo overflow%s, %d ibuf flood%s timeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550a, working fifost16650, broken fifost16650a, working fifons16550, broken fifons8250 or ns16450, no fifotl16c750, working fifons16750, working fifoAu1X00 UART, working fifons16650, no ERS, working fifoOMAP UART, working fifoIngenic UART, working fifoTegra UART, working fifoBCM AUX UART, working fifois_consoleforce_consolecan't re-init serial console @%lx txfifo disabled unable to allocate ring buffer 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT atarst%s channel %d: reset failed for drive 0 drive 1__wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xferatapilost interrupt%s:%d: %s %s:%d:%d: %s type: %s tc_bcount: %d tc_skip: %d atapollatadrdyatacnfatardl%s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%scompat_utilcrypto_core_constant32[0] == le32dec(&sigma[0])crypto self-test failed: %scrypto_core_constant32[1] == le32dec(&sigma[4])crypto_core_constant32[2] == le32dec(&sigma[8])crypto_core_constant32[3] == le32dec(&sigma[12])block[i] == le32dec(&out[i*4])expand 32-byte kinvalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full.5%s: %s rates: %s%d%sMbps%s: no 802.11 instance! 11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: control frame%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: Invalid key length %u, expecting %u [%s] Missing ExtIV for AES-CCM cipher not enough data in following buffer, m_len %u need %u [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] Discard frame due to countermeasures (%s) [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: too short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6Dtoo short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %umgtreceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%x[%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed reassocWPARSN, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handled[%s] %s compat_20link-layer statistics and controlsIEEE 802.11 WLAN statistics and controlsieee80211%s: sysctl_createv failed, rc = %d client/peer stationsvap%uinact_runinact_probeinact_authinact_initdriver_capsbmiss_max%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table 0x%p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %s: free all nodes in %s table %s %s table %s: %s[%u] still active ????ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c %s: scan set:%s%u start chan %u passive%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entryneighbor%s: creating ibss %s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s %s: chan %d->%d begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02xkey map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d %s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s unable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! %s %s table, inact %u Cannot allocate key index map with %u entries scanena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!not enough room, need %u got %zu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %d (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl0x%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s->%s) data type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon misswlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtscf_endcf_end_ackreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocdeauthreserved#13reserved#14reserved#15rssadaptexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds %d-byte, T[%d.%d] = %dexternal%hu.%hhu%s:%hhuigmpplinetigmplla_lookup: new lle malloc failed inmltplmulticastsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlinpcbpl%d.%d.%d.%d%s:%huinterneticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutbmcastechoICMP: redirect failed to register timeout for route to %s, code %d icmp_errorforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumdad_countanonportalgoavailableselectedreserve%s: refusing to send from invalid address %s (pid %d) maxfragpacketsipfrenplrip_abortrip_acceptpcblist(unknown)TCP: invalid wscale %d from %s, assuming %d tcpipqepltcp_pulloutofbandsynpl%s: impossible (1)%s: impossible (2)m_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULL%s: no template%s: %d < %dsackholepltcp_inittcpcbpltcp_new_iss: unreachablerfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnmaxretriesglobalmaxholesglobalholeslocal_by_rttdropiss_hashabcaggressivemsltremoteremote_thresholdvtw%s: af %dtcp6inet6newrenocubic%s: could not allocate %zu bytes for hash anchors%s: could not allocate %zu bytes for fatp_t array%s: could not allocate %zu bytes for vtw_t arrayudp_abortudp_acceptudpchecksumrandom_startrandom_pickdoublehashrandinc(src=%s dst=%s tgt=%s)%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d %s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s %s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6nd6_prunend6_delaynd6_umaxtriesnd6_mmaxtriesnd6_useloopbacknodeinfond6_maxnudhintmtudisc_hiwatmtudisc_lowatnd6_debugnd6_drlistnd6_prlistmaxqueuelen%s: ENOBUFS in icmp6_error %d %s: in6_setscope failed IPv6 address: "%s" is not on the network %s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s %s: the prefix length of an existing (%s) autoconf address should not be changed %s: addmulti failed for %s on %s (errno=%d) in6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctlprefix ioctls are now invalidated. please use ifconfig. %s: %s marked tentative %s: %s marked detached in6_if2idlen: unknown link type (%d) in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 header%s: never found a good ID %s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled %s: failed to configure the loopback address on %s (errno=%d) %s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address in6pcbpl::ffff:%s[%s]:%huinternet6Cannot forward from %s@%s to %s@%s nxt %d (%s) unspec/srcbcast/mcastmcast/dstsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %dip6accept_rtadvrtadv_maxroutesrtadv_numrouteskeepfaithlog_intervalhdrnestlimitauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedrr_prunev6onlyauto_linklocaladdctlpolicyuse_tempaddrprefer_tempaddrtemppltimetempvltimemaxfragsuse_defaultzonemcast_pmtuneighborgcthreshmaxifprefixesmaxifdefroutersmaxdynroutesip6_init%s: off < sizeof(struct ip6_hdr)%s: m == NULL%s: packet to an unready address %s->%s pim6register_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not splitmulticast_kludgeregen_tmpaddr: failed to create a new tmp addr, errno=%d nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 which needs %lu scope error in prefix list (%s) scope error in router list (%s) nd6_timer%s: workqueue_create failed (%d) %s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt %s: Cannot enable an interface with a link-local address marked duplicate. %s: can't allocate llinfo for %s (ln=%p, rt=%p) %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 %s: invalid hlim (%d) from %s to %s on %s %s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) %s: %s: starting DAD for %s %s: preferred lifetime(%d) is greater than valid lifetime(%d) defrouter_delreq: error %d deleting default router %s on %s %s: %s/%d is already on-link %s: failed to find any ifaddr to add route for a prefix(%s/%d) on %s %s: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d rtpref: impossible RA flag %x %s: %s/%d is already off-link %s: failed to recover a prefix %s/%d from %s to %s (errno = %d) %s: failed to delete route: %s/%d on %s (errno = %d) %s: lladdrlen mismatch for %s (if %d, RS packet %d) %s: called unexpectedly (forwarding=%d, accept_rtadv=%d) nd6_defrouter_select: more than one router is installed defrouter_addreq: error %d adding default router %s on %s %s: failed to make %s/%d offlink on %s, errno=%d %s: failed to make %s/%d offlink, errno=%d %s: failed to make %s/%d onlink, errno=%d nd6_prelist_remove: negative count on %s %s: failed to find a good random IFID %s: failed to find a unique random IFID %s: ifa update succeeded, but we got no ifaddr nd6_defrtrlist_del: negative count on %s %s: src %s is not link-local nd_ra_input: lower CurHopLimit sent from %s on %s (current=%d, received=%d), ignored %s: invalid option len %d for prefix information option, ignored %s: invalid prefix len %d for prefix information option, ignored %s: invalid prefix %s, ignored %s: failed to make the prefix %s/%d on-link on %s (errno=%d) %s: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p %s: IFID undefined (%s) %s: invalid prefixlen %d for %s, ignored %s: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: %s is already configured %s: failed to make ifaddr %s on %s (errno=%d) %s: failed to create a temporary address, errno=%d %s: bogus mtu option mtu=%lu sent from %s, ignoring %s: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring %s: lladdrlen mismatch for %s (if %d, RA packet %d) raw6%s: assumption failure (non 0 ID): %s%%%d %s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s siteorganizationglobaludp6%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket addr 0x%xiicintr: I2C bus unable to create intr thread i2c-indirect-configi2c-child-devicescookiecompatibleWARNING: ignoring bad child device entry for address 0x%02x WARNING: ignoring bad device address @ 0x%02x %s at %s addr 0x%02xi2c-indirect-device-whitelistinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-byteunknown probe strategy '%s'; defaulting to '%s' WARNING: intr handler list not empty WARNING: proc handler list not empty i2cexec,i2c_bitbangi2cexeciic at %smii_attach: phyloc and offloc specifiedmiimii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverbosemiiautmii_phy_setmedia: MASTER on wrong mediaHomePNA110baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDXcouldn't establish power handler: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX, BCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyno media presentDP83840 10/100 media interfacensphyDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyterQS6612 10/100 media interfaceqsphyi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphyi82553 10/100 media interfaceiophy: 3Com internal media interface ignoring this PHY, non-zero instance no media present exphy_service: can't isolate 3Com PHYexphy100baseFX, 100baseFX-FDX, LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphyICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphyusing Seeq 84220 isolate/reset hack Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphyDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphyAm79C901 HomePNA 1.0 interfacepnaphy: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroy%s: emergency X server detach added (%s, %s emulationwsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_common_attach: no memory kbdmux %d: console (%s, %s emulation), using %swsswscreen %d deleted wsdisplay at %swsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDIDdumb%s: ESC in kernel output ignored vt100[>24;20;0cP2$u%s%dP0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %dOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCOpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~wseventdefault_version%s: unknown version %dwsevent_read mux %dcannot load keymap: console keyboardattach error=%d couldn't register as input device connecting to %s wskdetwskbd_detach: %s didn't detach wskbd at %s%s: event queue overflow wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux_getmux: no memory for mux %d wsmuxwsmux: attach out of memory %s: disconnecting from %s wsbell at %swsbell%s: fontwidth assumptions botched%s: font stride assumptions botched%s: depth not supported %s: font table is empty %s: couldn't lock font %s: bits not aligned on 32-bit boundary %s: stride not aligned on 32-bit boundary ccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldfacecd9660noplRRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] cd9660utf8_joliet%/@%/C%/Eroot_devicecd9660_strategy: spectag VT_ISOFS, isofs vnode msdosnoplmsdosfhplloadvnode(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld %s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfsRRaArrAamsdosmsdosfs_write(): bad file typerename: lost dir entrymsdosfs_rename: updating .. in root directory?msdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu bind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs send error %d for %s nfsd send error %d timer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s not respondingnfsrvdescplbuild > MLENnfsumntnfsstatsiothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llxwriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad v_usecount%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%s%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%s%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %suid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s %s: freeing free inodefile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free trimwqtrimwqcv%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %s%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on listffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %d%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsdoclusterreaddoclusterwritedoreallocblkslog_changeoptorg.netbsd.kauth.systemffs_modcmd: can't listen on system scope. appleufsffsinoffsdino1ffsdino2, not mounting%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2%s: options QUOTA2 not enabled%s %s: file system not clean (fs_clean=%#x); please fsck(8) %s: lost blocks %lld files %d %s: `-o softdep' is no longer supported, consider `-o log' %s: rofs mod, fs=%smfsidlmfs_rootmfs_ioctl not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_closemfs_initminiroot() called more than once%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: bad dir ino %ju at offset %d: %s missing NUL in namenot roundednull entryi_size too small%s: too big%s: nospace%s: newblkhard-linked directoryufsdirufs_whiteout: unknown opufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qdinvalid uio rw: %damapplcownowcownowpageanonpllivelockuao_getpageuao_getuao_create: hashinit swhash faileduao_create: swslots allocation faileduaoeltpluao_put: strange, got an out of range flush 0x%jx > 0x%jx (fixed) uao_put%s: impossibleuao_detubc_allocubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_object%s: error=%d udv_detachudv_faultudv_attachflt_noram5flt_pmfail1flt_pmfail2anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpgloanagainloanzeroloanuopguser_va0_disablevmmpeplvmspplvm_map%s: kernel object %p %p vmmeterloadavguvmexpuvmexp2maxslpuspaceidlezerominaddressmaxaddressthread_guard_sizeuobjwirepguvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! fork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slab%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start >= enduvm_physseg_plug() failed at boot.%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG %s: Tried to unplug unknown range ractx%s: swapdev not in list%s: vnode type 0x%x%s: swap to sparse file%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswp vnxswp vndswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failedturning of swap...stopping swap on %s failed with error %d uvn_fp1uvn_fp2copy-cred-on-forkbufq_disksortbufq_fcfsNetBSD-CORE%s@%dELFexec_elf32#!exec_scriptvmcmdkillsextendscalls/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)haltrebootuse absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initfork aiodonedcannot mount root, error = %d fork pagedaemonioflushfork syncer%s %s (%s)total memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/initmaxvnodesmaxprocmaxfilesargmaxhostidprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timemaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetidownergroupno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvfsddbvendorsecurityAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_ticksclockinterruptCondition variable%.*spid %d (%s): %s write of %zu@%p at %lld failed: %d cpu%dfdcloseincrease kern.maxfiles or MAXFILESfdfilefiledescfile2dup2EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSexecargsshould not happenpspawnlwpwaitkernel mapping failed %d netbsdinit died (signal %d, exit %d)orphaned traced processincrease kern.maxproc or NPROCforkmxforkulimidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx softintpserialize%s: %s caller=%pKernel locklwpplmaxlwpsigwaitvfork(zombie)swapperWARNING: module error: built-in module %s can't find builtin dependency `%s'built-in module %s prerequisite %s failed, error %dbuilt-in module %s failed its MODULE_CMD_INIT, error %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size (got %zu, wanted %zu)DEBUG: module: TRUEFALSEunload requested for '%s' (%s)module `%s' not foundmodule `%s' busy (%d refs)cannot unload built-in secmodel module `%s'cannot unload module `%s' error=%dunloaded module `%s'module `%s' declined to be auto-unloaded error=%d%s: builtin module "%s" init failed: %dmod_unld/stand/%s/%d.%d/modulesbuiltin %s failed: %d moduleautotimemodunload%s: %dmodule `%s' pushed by boot loader already existsduplicate bootlist entry for module `%s'unable to load `%s' pushed by boot loader, error %dunable to fetch_info for `%s' pushed by boot loader, error %ddependentuse -f to reinstate builtin module `%s'%s module `%s' already loadedout of memory for `%s'cannot fetch info for `%s', error %dmodule `%s' has invalid class %dmodule `%s' built for `%d', system `%d'forced load, system may be unstableincompatible module class for `%s' (%d != %d)dependency name mismatch (`%s' != `%s')module with name `%s' already loadedcircular dependency detected for `%s'required module name `%s' longer than %dself-dependency detected for `%s'recursive load failed for `%s' (`%s' required), error %dunable to affix module `%s', error %dmodule properties failed for %smodcmd(CMD_INIT) failed for `%s', error %drecursive load causes duplicate module `%s'module `%s' loaded successfullyLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistLoading plist from %splist load returned error %d for `%s'noautoloadautoloading is disallowed for %skern.module.path=%s owner field : %#018lx wait/spin: %16d/%d locking against myselfmutex_init: impossible typeMutexmutexphysiodphysioDevices without power management support:%s: %s is suspended by %s (delegator %s) pmfsuspensortransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) %s: %s suspension %s (delegator %s) removed by %s classresume failed Powering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.%s-self%s: class suspend %s: driver suspend %s: bus suspend %s: suspend enter %s: suspend exit Flushing disk caches: Suspending devices:%s: bus resume %s: driver resume %s: class resume %s: resume enter %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueueprocplexpose_addressproc2proc_args%s (pid %d) changing logname from %.*s to %s rasplimitplpstatsplcurprocpaxflagsrlimitcputimefilesizedatasizestacksizecoredumpsizememorylockeddescriptorssbsizevmemoryusestopforkstopexecstopexitrnd: source "%s" failed continuous-output test. rnd: source "%s" failed statistical test.rnd: disabling source "%s". rndsrcrndsamplernd: seeded with %d bits printfautoconfrnd: bad seed length %d rnd: bad seed checksum requesting entropy from dead rndsink: %prndsink %p in unknown state: %drndsinkdestroying dead rndsink: %pcacheht_timebalance_periodaverage_weightmin_catchtimesoftintskpreempt_priupreempt_prirunqueue pullrunqueue pushrunqueue stayrunqueue localizeowner/count : %#018lx flags : %#018x Reader / writer lockrwlock%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old paniccrashmecrashme_enable%s: unable to remove %s from sysctl null_derefnull dereferencesigactsksiginfotrapsignaleventswitchsorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d proc_stoptraceWARNING: softint_establish: table full, increase softint_bytes softdissoft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorybiosoftint_picklwpwedge:NAME=parsedisk%s%lluswap dumps on %suse one of: %s[a-%c] none halt reboot md0 (default %sdump device (default %sb)file system (default %s): use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockimmediatesetrunnable: lwp %p state was %dWARNING: negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLkernel %sassertion "%s" failed: file "%s", line %d %s: rnode %p wrong version sysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content len %d: end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_mspooloverpooloverseer/%d@%dthreadpool job %p ran after destructionpoolthrdpoolthread/%d@%dthrdplcrthplthrddeadjobptimerplptimersplnanoslppid %d attempted to set the (obsolete) kernel time zone callout_init_cpu (2)late/%ucalloutwait/%utstilepltstileturnstile_unsleeptodr_attach: TOD already configured WARNING: preposterous time in file system WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time uidinfoproccntlwpcntlockcntsemcnt%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xrttsconfigure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s.%d, %s dvl_nlock %d dvl_nwait %d dv_flags %x %s with registered handlersdevice-attachdevice-detachcfgmiscdetachallconfigintrconfigroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namelocatorsinterface-attributesconfig_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_attach: allocation of device softc failedFound %s (root)%s at %sWARNING: power management not supported root device %s not configured done. WARNING: %d error%s while detecting hardware; check system log. detaching %s, unable to detach instance init rollbackfiniconfig_cfdata fini rollback failedfini rollback unsupported blist_meta_alloc: allocation too largeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangebufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbackcprng %s: reseeding with partial entropy cprng %s: NIST Hash_DRBG reseed failedNIST Hash_DRBG failed self-testurandomarandomcprng %s: NIST Hash_DRBG instantiation failedcprng %s: creating with partial entropy sysctlcprng %s: NIST Hash_DRBG failedureadc: non-positive residureadc: non-positive iovcnt%s: block majors exhausted%s: character majors exhaustedwrit%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and partition table is fullno raw partition and disk reports bad geometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitdisk-info%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cevcnt/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashdone: invalid table type KMGTPE kMGTPE%qu%s%c%snointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipiWARNING: ipi_register: table full, increase IPI_MAXREG kcpusetkcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-2048kmem-4096kmem-8192kmem-16384kmem-8kmem-16kmem-24kmem-32kmem-40kmem-48kmem-56kmem-64kmem-80kmem-96kmem-112kmem-128kmem-160kmem-192kmem-224kmem-256kmem-320kmem-384kmem-448kmem-512kmem-768kmem-1024not modular%s error: %s,%zu: %s lock address : %#018lx current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pklogmsgbufsizemsgbufrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) page %p, nmissing %d, time %u %s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u%s: [%s] ph %p poolid %u != %u%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s: [%s] page empty%s: [%s] page header missing%s: [%s] %u >= %u%s: [%s] %p already freedMust specify a pool to print. POOL CACHEPOOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer entry uncontended %llu contended %llu cache layer empty groups %u full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p empty cache groups: pool item size %zu too large, use a custom allocator(null)Skipping crash dump on recursive panic panic: [% 4jd.%.*ld] %s: table is full - %s %s: table is full autoconfiguration error: exclusive accesspsrlzspecificdata_domain_delete: not implementedspecificdata_setspecificbtallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehash%s: workqueue_create %d static_bt_inusestatic_bt_countInvalid IPL: %dxclocvxchicvcrosscallunicastxcallxcall/%uaio_process: invalid operation code aioworkaiodoneaio_jobs_poolaio_lio_poolposix_aioaio_listio_maxaio_maxsys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s compat_80mqmsgplposix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqsendcvmqrecvcvmqparkedpsetpsets_max%d:1,%d:2direct_selectcompat_16posix_schedpri_minpri_maxsocketttyrub: would panic c = %d, val = %d not a controlling terminal no foreground process group empty foreground process group load: %d.%02d cmd: %s %d [%#lx/%d%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutftkstatninnoutcanccrawccqsizecompat_60compat_43ttyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlcincrease kern.maxptysputc: required clalloc b_to_q: required clalloc accfaccf_streamseqpacketdgram%s: source too long, %d < %d bytesunix: inet: inet6: link: atalk: (unknown socket family %d)bad family %hhumbuf %p already freedmsizemclbytesnmbclustersmblowatmcllowatmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)%s: len > MHLEN%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]%s: no header (m = %p)offset %04d: %s: too short mbuf chain (%u < %u) %s: cannot read header ARP: AddressType = %u(ETHER) IEEE802) unknown) ARP: Protocol Address Format = %u ARP: Protocol Address Length = %u ARP: H/W Address Length = %u ARP: Operation = %u(REVREQUEST) REVREPLY) INVREQUEST) INVREPLY) Cannot parse. Cannot read payload ARP: Ether Src = %s ARP: IP Src = %s ARP: Ether Tgt = %s ARP: IP Tgt = %s ICMP: Type = %u(Echo Reply) Destination Unreachable) Source Quench) Redirect) Time Exceeded) ICMP: Code = %d ICMP6: Type = %u(Packet Too Big) Parameter Problem) Echo Request) MLD Listener Query) MLD Listener Report) MLD Listener Done) Router Solicitation) Router Advertizement) Neighbor Solicitation) Neighbor Advertizement) ICMP6: Code = %u TCP: Src = %u TCP: Dst = %u TCP: Seq. = %u TCP: Ack. = %u TCP: Header Length = %u TCP: Flags 0x%02x : FIN SYN RST PUSH URG ECE CWR TCP: Windows Size = %u TCP: checksum = 0x%04x TCP: Urgent Pointer = %u %s: cannot read TCP option TCP: OPTION: NOP TCP: OPTION: MSS = %d TCP: OPTION: wscale = %d TCP: OPTION: SACK OK TCP: OPTION: TIMESTAMP = %u, ECR = %u TCP: OPTION: unknown (%d, len = %d) UDP: Src = %u UDP: Dst = %u UDP: Length = %u IP: Version = %u IP: Header Length = %u IP: ToS = 0x%02x IP: Packet Length = %u IP: ID = %u IP: Offset = %u IP: Flag 0x%04x (reserved) IP: Flag 0x%04x (evil flag) IP: Flag 0x%04x (don't fragment) IP: Flag 0x%04x (more fragment) IP: TTL = %u IP: protocol = %u(%s) IP: checksum = 0x%04x IP: Src = %s IP: Dst = %s IPv6: Version = %u IPv6: Flow INFO = 0x%07x IPv6: Payload Length = %u IPv6: Next Header = %u(%s) IPv6: Hop Limit = %u IPv6: Src = %s IPv6: Dst = %s Cannot read option IPv6: Stripped Hop-by-Hop SPPP: Address = %d(ALLSTATIONS) SPPP: Protocol = %d(LCP) PAP) CHAP) IPCP) IPV6CP) IP) IPv6) MULTICAST) UNICAST) Keepalive) No parser for address %d, protocol %d %s: too short mbuf chain (%u, %u) PPPoE: Version = %u PPPoE: Type = %u PPPoE: Code = %u(PADIPADOPADSPADTPPPoE: Session = 0x%04x PPPoE: Payload Length = %u No parser for PPPoE control frame. Unknown PPPoE code. ETHER: DST = %s ETHER: SRC = %s ETHER: TYPE = 0x%04x(PPPoE) ARP) IPv4) No parser for AF %d IPv6 Hop-by-HopICMPIGMPTCPUDPESPAHICMP6unixposixsemmaxpsemksemsomaxkvasbmaxsooptionssokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lu%s: message too large %d mbsonamembcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdataunp_disconnect1uipc 1uipc 2unp_attachunp_connect1unp_threadunpgcuipc_init %duipc_usrrequipc 4inflightdeferredbuf mem pool index %dforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbioplbuf%ukbuf%ubbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbflushbiolockbiowaitbiodone2 alreadyallocbuf: buffer larger than MAXBSIZE requestedcachegcncachenchinit %dnamecacheentries scannedentries collectedover scan targetunder scan targetforced reclaimsnamecache_statscwdidirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.fstypesmagiclinkspnbufpllf_findoverlap: defaultlockfchrooted pid %d uid %d (%s) detected outside of its chroot namei_simple_convert_flags: bogus sflags /../earmzauruskernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dot%s: failed to start extattr: error = %d syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system failedunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... ILLEGALvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd)%slrulisthd %p ROOTSYSTEMISTTYMAPPEDMPSAFELOCKSWORK TEXT EXECMAP WRMAP WRMAPDIRTYONWORKLSTDIROPfiledelaydirdelaymetadelayvflushbuf: not dirty, bp %pvflushbuf: dirtyACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVCHRVLNKVSOCKVFIFOVBADVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFSsymlink-target%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dfdesckernfsafsfstchgfstcnt%s: cannot reclaimdead but not clean%s: bad ref countvcacheplvcachevdrainvdrainwt%s: holdcnt vp %p%s: cannot lock%s: neg numoutput, vp %pxattr-namexattr-valxattr-listsystem.user.security.trusted.vop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_bwritedead fs operation useddeadtag VT_NON, dead vnode fifordfifowrtag VT_NON, fifo with %d readers and %d writers/usr/src/sys/miscfs/genfs/genfs_io.cgenput%s: bogus command %dgenfs: bad oplayerfs tag VT_LAYERFS, vp=%p, lowervp=%p spec_ioctlspec_read typespec_write typespec_fdiscard: not a device spec_close: spurious pgrp refspec_close: not specialdev %llu, %llu spec_node_destroy: corrupt hashfictitiousdefault labelWARNING: %s: total unit size in disklabel (%llu) != the size of %s (%llu) %s: %llu trailing sectors not covered by disklabel WARNING: %s: end of partition `%c' exceeds the size of %s (%llu) raidframecgd%s: blkno (%llu) + size / DEV_BSIZE (%zu) > sc->sc_size (%llu) %s at %s (%s) deleted dkdrn%s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) %s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFS%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfs%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTccdvmkcorevmfsvmwresvntfsext2fsmdidle%s: cfattach_attach failed %d %llu %uurandom%urndtemprndctxrndpseudoopen hardopen softbpfbpf_mcpybpf_change_type%s: softint_establish() failed%s: no bpf_if found for %smaxbufsizepeersbpfattach%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterbpfops%.*s/%hhu#%slink#%huif_ifqmaxlendropsifnetifasdl%s: could not attach sysctl nodes sndqrcvqif_detach: WARNING: AF %d not purged UPDOWN%s: lost link state change %s too many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. invalid argument to %s%s: can't handle af%d ether%s: invalid ifp (sdl_index %d) llentrypllooutput: no header mbufif_loopifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedpfilpktqsyncpktqrenqMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find our annotation rn_delete: couldn't find us radix already initializedrn_init: radix functions require max_keylen be set rn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 rtentryrt_freert_updatertentplrttmrplrt_timerrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 %s: unable to delete rtentry @ %p, error = %d rtfree 2route_purgeifroute_abortroute_accept%s: message too long%s: queue full, dropped message %s: unknown command %drtableroutekeeplog_movementslog_permanent_modifylog_wrong_iface%s: %s not ready arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! duplicate IP address %s sent from link address %s %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s %s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: called with duplicate address %s(%s) %s: %s: ARP announcement complete for %s %s: arp_setgate failed %s: bad gateway value %s: failed to %s llentry for %s on %s %s: ouch, empty static llinfo for %s arpintrrevarp%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuencapelemip_encap cv%s_wqinput%s: could not create a sysctl node for %s inputqis-rootmodelsTraditional NetBSD: Superuserorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d is-securelevel-aboveTraditional NetBSD: Securelevelorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d Traditional NetBSD: Extensionsorg.netbsd.secmodel.extensionsextensions_modcmd::init: secmodel_register returned %d curtainusermountuser_set_cpu_affinityextensions_modcmd::fini: secmodel_deregister returned %d Traditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionscryptofssptmdrvctltapveriexecfwucycomutoppybthubamrlockstatputtersrtdrmaltmemtwacpuctlpadzfstprofisvvideohdaudiouhsorumpblknpfdtvfilemoniscsitpmmfiseepromdtracespiflashluaspkrhdmicecnvmeqemufwcfgautofsgpioppsnvmmkcovspiipmicttyphysconptcqmsofconsfdtunvidcconsoleopmsiplofromscrfcomjoymidisequencervcodawsdisplaywsmouseusbuhidulptscsibusraidugenucomuriouscanneropenfirmbiconsdevsacommlywsfontagppciiopaltqmlxplcomclockctlirframecirradiokttcpixpcomsysmondmoveriosscomksymsepcomtslcdtwensmbwdcpxapcicpxamcisdmmcbuswsemuldisplaydevwskbddevdrivechannelgpiobuskbdmuxcontrollerindexdackirqintrbaseKernel RNG "%s" monobit test FAILURE: %d ones Kernel RNG "%s" poker test failure: parameter X = %lld.%lld Kernel RNG "%s" long run test FAILURE: Run of %d %ds found Kernel RNG "%s" runs test FAILURE: too few runs of %d %ds (%d <= %d) Kernel RNG "%s" runs test FAILURE: too many runs of %d %ds (%d >= %d) unusedv6v7v71kv8otherhpfsadosfilecorejfs2vinumudfsysvbfsefsnilfsminixfs30%llostringpropstng<>&plist version="1.0"?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl %s %s SIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfacesvlantagSIOCSETVLAN vlan: %d parent: %s %s: getvlan-vlanifVLAN tagfatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEVinvalid major numberinvalid minor numbertoo many fields for formatusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... kern.driversinvalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1scosolarissunossvr3svr4ultrixffs@mmmmD%=mF@MYammm mm kmmnn*n?nRn an@mn~nnn@n.inn n.nnn%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node %s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llugetargs, [%s: %s]realpath `%s'unionpuffs|%s on %s type %.*s: %s already mountedforcemount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %sOnly one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousautomountedextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfefsnilfsstrdupbnorripbgensbextattbnojolietbnocasetransbrrcaseins-q7qu0m9cBqk mm kmk@IqPqUq^qhqlqqqxq usage: %s [-o options] special node getmntoptsegijo:r%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead.-q7qu0m9cBqk mm km0@1mO@ksD%k@mo:mount table fullincorrect super blockspecified device does not match mounted device%s on %s: %ssoftdepbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror-q7qu0m9cBqk mm km0@1k@usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %sbsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoac-q7qu0m9cBqk mm kmkk@M||PH}  }@}}!}'},}H0} h@LL{R{6}[{e{o{ z{@recvrpcrpc_getportrpc_callsendrecv[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]conflicting version optionsillegal -a value -- %sillegal -D value -- %sillegal -I value -- %swsizerdirsizeleasetermreadaheaddeadthreshtimeoretransillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %s23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %d%s: reject, astat=%d, errno=%d %s: error = %d %s: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %s%s: can't read disk label; disk type must be specified%s partition type is not `%s'ʄ0h߅ ?\!HpCcWTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount pointrdfs: read error for sector %lld: %s setblock bad fs_fragshift %d wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). isblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d first cylinder group ran out of spaceillegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask%s (%s)0.0.0.0 ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sshutdownSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()۷߷usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %llu file %s unallocated block in symbolic link %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s seek error extracting inode %llu, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %llu, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%llunot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY)R|0b*UPBROADCASTDEBUGLOOPBACKPOINTOPOINTRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING0123456789abcdefUGHRBD M@dmCLS1@2plbatalkhopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsendpipeshowssthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmpls%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad value sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%d%-*.*s %-*.*s %-6.6s FlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspechw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device %s%s%cswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node %s: not currently mountedumount_%s%s: execvpfRfetch_ftpaS***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20210826NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'Unsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. parse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%d%c%c%c%d%cPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. httpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. loginmachineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamNetBSD gzip 20170803malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.10failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlVcan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular file.gz4HS- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESkrklkukdkPkNkh@7kDhcxndadbticmsovb|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: filename expected%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: invalid command code %c%lu: %s: extra characters after \ at the end of %c commandw commandread commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aElnru] command [file ...] %s [-aElnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EI::ae:f:i::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberrabetbhfprdldvcupndipausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i.1<H$CLڻ$YS$aS$mv$*$$$ټ$'$S$S$S"$!)ܹ$6N$=D0$NS$X.$a.ۺ$k|$p$pؽ$x$$$$'$S$ S$x$$##$4S"$?M$$_'!$kS?$wS>$PLNAME= n &09@OV\chp u~,         !"#$%&'  IÒ_ 0Jђaq  &09@OV\chp u~, efvy{K]7) &09@OV\chp u~, dIwim----------------------------------- - --------------------  @//tmp/usr/var$$$$   0 Details for index GPT part -  *=@EJ.MSinXn n#\annn jsxpi5c cjjuk-jj` ddgego`b`d?`o`'r1s r}qtk3b[a]aaa_a. R0R0  s SFH0eC쬞 SFU0eCLHah!IdontNeedEFIV(s*K>;`|nQn- q+kw|nQn- q+|nQn- q+|nQn- q+|nQn- q+=rGy=iG};Mt?mWC 3KOOyD<#*=(&3Dh&R00\ M}-CT-чHe-чH zZIчH.IчHIчH2IчH S'@ )Ѹ*1@ )Ѹs1x )Ѹdmm%I}~~_݃u IU ٙ}m'  . AR ! 4B/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdmbrgptre-enterAdditional packages.tgz/sbin/halt -q/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconfGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6) [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeNoneOnOffunchangedDelete?reinstall sets forupgradeNetBSD/zaurus 9.4_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksmount point (or 'none')secMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-9.4_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-9.4_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-9.4_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-9.4_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsGamesManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-9.4_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-9.4_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Operation not supported!Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsSwitch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Bootable flagSafe eraseUndo changesUnconfigureEditForce umountRemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelUUIDGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionInstalling boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg] [-p] where: -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -r release override release name -C bg:fg use different color scheme -p only run the partition editor, no installation Dr:f:C:m:psysinst: screen too small /usr/share/sysinst/catalog9.4_STABLEzaurusxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-9/latestftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/9.4/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filesysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.hw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %stmpfs%s (%s@%s)%s (%s, %s)%s (%s, %s %s)-t -o disk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2 %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %d %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%sprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*%-30s %s/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/TZ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'raidctlvndconfigcgdconfigdkctlrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.d/random_seed stop/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICkern-C700gamesrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %sNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /dev/r%saNetBSD9/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s pkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10schpass -s %s rootsource for 3rd-party packagespasswd -l rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%cfictiousdisklabel -r %s%s (%u)/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s %*s %s. %sUser answered no to destroy other data, aborting. %s [%s %s]%llu%s (%llu)%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %spartmanlvol%.2dvg%.2dmkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d %-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%lliPartman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesgpt destroy %s%s_%lli@%lliNAME=%sStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt -rq header %sgpt -r show -a %s 2>/dev/nullPri GPT tableSec GPT tableSec GPT headergpt %s %s -b %llu %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1138: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1100: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sv7sysvv71kv8otherhpfshfsjfs2appleufsminixfs3vmfsvmwresvefibioslinux-dataapplevmcorevmreseredbiosbootbootmebootoncebootfailednoblockio%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxapple-ufsBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumfbsd-zfsFreeBSD ZFSLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapVMware VMkernel core dumpVMware reserved/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2100: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1743: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1773: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2067: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2193: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2198: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI BootS***************************************************************************************************************************************************************************************************************************************usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputn1^f-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu ping6: wrote %s %d chars, ret=%d --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000getaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmaprefusedunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s SuccessRefusedIPv6 addresscontrol_handle1control_handle_datacontrol_writeonedhcpcd_reportssiddhcpcd_initstate2dhcpcd_getinterfacesconfigure_interface1dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_prestartinterfacesignal_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2019 Roy Marplesmain duid_getxsocketif_discoversplitvadd_environparse_optiondefault_configread_config#bi\cdv4e.fz4g/h/i-j.k4lA9m4no4pHq^r4s4\t$0uH0v4wR,x4ziy4A4B4C-D4Eu>F4G4H0IOJ5K5LoWM5N5O5P,5QST45U>5VH5WR5X\5Zt#1k54t56o4|z~}5}5555555555AAA559F255o9~256 66"63616]86@6M66S6Y6a6f6v6'46  a a rt_new0  rt_buildrt_deleteM M \.9Z+59?9H9O/{S9!36 55Z]&9make_envscript_runreason0123456789abcdefdhcp_envoption::;M;};;;;<.<\<<<<< =Q=o====>?>e>z>>>>>>???i?{??????@@+@@I@_@~@@I@@@@@ A A0A@AOA_AA@AOAAA??OAAAB6BTBsBBBBCC>9C^Cif_opensockets_osYRVDZD^Dif_initrtif_ifa )( PT@P HEPT$ @DCread_leasedhcp_openbpflog_dhcpyMMMyMdhcp_bindMKMMCDKMcF Mdhcp_start1dhcp_initdhcp_handledhcpdhcp_readbpfdhcp_readudpdhcp_recvmsgdhcp_dumpipv4_deladdripv4_getstateipv4_addaddripv4_handleifaipv6_readsecret^^ipv6_deleteaddripv6_addaddr1ipv6_newaddr^ipv6_getstateipv6_addlinklocalcallbackipv6_regentempaddripv6_tempdadcallbackipv6nd_dadcallbackipv6nd_sendrsprobeipv6nd_startrs1ipv6nd_rtprefipv6nd_applyraipv6nd_expireraipv6nd_handledataipv6nd_recvmsgipv6nd_handleraQ^Z^e^n^XXu^ X] ~^^]^^#^/^=^dhcp6_checkstatusokdhcp6_openudpdhcp6_sendmessagedhcp6_startdiscoverdhcp6_startinformdhcp6_startrenewdhcp6_startrequestdhcp6_startrebinddhcp6_writeleasedhcp6_recvifdhcp6_recvdhcp6_recvmsgdhcp6_start1 '')*PQ'|}wdhcp6_startinitdhcp6_startconfirmdhcp6_startreleasedhcp6_dump/var/run/dhcpcd.unpriv.sock/var/run/dhcpcd%s%s.sock%s: connected to Access Point `%s'%s: IAID conflicts with one assigned to %sEXPIRE6EXPIRE%s: removing interfaceDEPARTEDSTOPPEDNOCARRIERPREINIT%s: waiting for an %s addressexiting due to oneshotforking to background%s: pipe%s: fork%s: pidfile_lock %d%s: write%s: eloop_requeue%s: readforked to background, child pid %d%s: no profile %s%s: selected profile %s%s: confile file changed, expiring leases%s: carrier lost%s: carrier acquired%s: waiting for carrierDUID %s%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_startRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2received SIGPIPEreceived signal %d but don't know what to do with it%s: interface departed%s: interface updated%s: interface addedroute socket overflowed - learning interface state%s: if_opensockets%s: new hardware address: %s--version8.1.9--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[master] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 8.1.9 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd%s%s%s.pid%s: chdir `/'%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_mask%s: if_discoversending commands to master dhcpcd processsend OK%s: control_send%s: control_opensending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exit/var/run%s: mkdir `%s'/var/db/dhcpcd%s: pidfile_lockdhcpcd already running on pid %d (%s)%s: control_startdhcpcd-8.1.9 starting%s: interface not found or invalidno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: SO_RERROR%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init%s: no assignment: %snd_dhcp6_`%s' is not a valid CIDR`%s' is not a valid IP address/libexec/dhcpcd-run-hooks%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %suserclassinvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%sptrbothdisableinvalid value `%s' for FQDNclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption `%s' does not take an IPv4 addressinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type `%s'ignoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundmudurloption %d requires an argumentunknown option: %s%s: fopen `%s'arpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbuf(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %saddingchangingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deleteddeleting - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinTESTSTATIC6ROUTERADVERTUNKNOWNPATH=%sinterface=%sreason=%spid=%difcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=falseif_down=%sif_down=falseif_up=trueif_down=trueprotocol=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueprofile=%sifssid=%s%s: executing `%s' %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed index uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%snd6_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_maskdefine 121 rfc3442 classless_static_routesdefine 249 rfc3442 ms_classless_static_routesdefine 33 request array ipaddress static_routesdefine 3 request array ipaddress routersdefine 6 array ipaddress domain_name_serversdefine 12 dname host_namedefine 15 array dname domain_namedefine 26 uint16 interface_mtudefine 28 request ipaddress broadcast_addressdefine 50 ipaddress dhcp_requested_addressdefine 51 request uint32 dhcp_lease_timedefine 52 byte dhcp_option_overloaddefine 53 byte dhcp_message_typedefine 54 ipaddress dhcp_server_identifierdefine 55 array byte dhcp_parameter_request_listdefine 56 string dhcp_messagedefine 57 uint16 dhcp_max_message_sizedefine 58 request uint32 dhcp_renewal_timedefine 59 request uint32 dhcp_rebinding_timedefine 60 string vendor_class_identifierdefine 61 binhex dhcp_client_identifierdefine 80 norequest flag rapid_commitdefine 81 embed fqdnembed bitflags=0000NEOS flagsembed byte rcode1embed byte rcode2embed optional domain fqdndefine 119 array domain domain_searchdefinend 1 binhex source_addressdefinend 2 binhex target_addressdefinend 3 index embed prefix_informationembed byte lengthembed bitflags=LA flagsembed uint32 vltimeembed uint32 pltimeembed uint32 reservedembed array ip6address prefixdefinend 5 embed mtuembed uint16 reservedembed uint32 mtudefinend 25 index embed rdnssembed uint32 lifetimeembed array ip6address serversdefinend 31 index embed dnsslembed domain searchdefine6 1 binhex client_iddefine6 2 binhex server_iddefine6 3 norequest index embed ia_naembed binhex:4 iaidembed uint32 t1embed uint32 t2encap 5 optionencap 13 optiondefine6 4 norequest index embed ia_taembed uint32 iaiddefine6 5 norequest index embed ia_addrembed ip6address ia_addrdefine6 12 ip6address unicastdefine6 13 norequest embed status_codeembed uint16 status_codeembed optional string messagedefine6 18 binhex interface_iddefine6 19 byte reconfigure_msgdefine6 20 flag reconfigure_acceptdefine6 23 array ip6address name_serversdefine6 24 array domain domain_searchdefine6 39 embed fqdnembed bitflags=00000NOS flagsdefine6 82 request uint32 sol_max_rtdefine6 83 request uint32 inf_max_rt%s: SO_USELOOPBACK%s: SIOCGIFALIAS%s: if_addrflags6net.inet6.ip6.use_tempaddrnet.inet6.ip6.temppltimenet.inet6.ip6.tempvltime%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSSIOCSRTRFLUSH_IN6SIOCSPFXFLUSH_IN6fwetapxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: open `%s'reading standard input%s: reading lease `%s'%s: %s: truncated lease%s not foundNAK:%s: %s %s %s `%s'%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease `%s'%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: timed out contacting a DHCP server, using last lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: dhcp_open%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: %s: short frame header%s: checksum failure from %s%s: received BOOTP for inactive interface%s: redirecting DHCP message to %s%s: DHCP lease expired, extending lease%s: DHCP lease expiredDUMP%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: %s: lifetime overflow%s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: pid %d deleted address %s%s: waiting for %s to complete%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: impossible RA flag %x%s: %s: router expired%s: expired address %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: reject RA (no option %s) from %s%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %snd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_addr%zu=%s%s: delaying IPv6 router solicitation for %0.1f secondsreachable againunreachable%s: %s is %s%s: DHCPv6 Vendor Class too big%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: ignoring unicast option as not masterdelayingunicastingbroadcasting%s: %s %s (xid 0x%02x%02x%02x), next in %0.1f seconds%s: no socket to send from%s: %s: sendmsg%s: sent %d times with no reply%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: DHCPv6 DAD completed%s: %s received from %sTIMEOUT6INFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: became stale%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to complete%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: no DHCPv6 server ID from %s%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: RECONFIGURE6 recv from %s, sending to all interfaces%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: confirming prior DHCPv6 lease%s: extending DHCPv6 lease%s: no advertising IPv6 router wants DHCP%s: failed to request information%s: DHCPv6 lease expired%s: failed to request address%s: failed to confirm prior address%05d %s%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6DUMP6Unspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\Bo = o!= o9= oU= m= o= o= = o= q= o> o> BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~oohdplohhxlooooooo q@oousq/etc/group/etc/master.passwdJPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal numberYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidfull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames faileddk%s: getwedgeinfo/rdk/rno match for `%s'Cannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresv0%llo%lld0x%llx%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMUTF-8Inkey wstate screwed - exiting!!!xdumbESCDELAYTABSIZE sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey state screwed - exiting!!!unknown5MS7)   #$      r?7QQj%^."Ar O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9beltc^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNSansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @61 [%p1%dSzOE}OM7 [%p1%dT [%i%d;%dR[?%[;0123456789]cODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMZS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B<1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd@BC{+?kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME/usr/share/misc/terminfo%s/.terminfoansivt100vt220wsvt25xterm%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range2Kn,X` %Kbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon # " "  "$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl     acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check@@ !1Aa  0@` #+3;CScs inflate 1.2.10 Copyright 1995-2017 Mark Adler deflate 1.2.10 Copyright 1995-2017 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa1.2.10need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cprop_string_append_cstringsrc != ((void *)0)/usr/src/common/lib/libprop/prop_string.c_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_errorctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist